Property Summary

NCBI Gene PubMed Count 50
PubMed Score 55.83
PubTator Score 103.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -4.668 7.2e-10

Gene RIF (37)

PMID Text
26019275 A novel in-frame deletion in the leucine zipper domain of CEBPE leads to neutrophil-specific granule deficiency.
25938438 our study provided evidence that CEBPE rs2239633 variant is associated with decreased risk of childhood B-cell ALL in Europeans.
25761407 variants within IKZF1, ARID5B, and CEBPE were associated with increased acute lymphoblastic leukemia (ALL) risk, and the effects for ARID5B and CEBPE were most prominent in high-hyperdiploid ALL subtype in the California Hispanic population
25568349 During neutrophil development, acetylation of lysines 121 and 198 were found to be crucial for terminal neutrophil differentiation and the expression of neutrophil-specific granule proteins, including lactoferrin and collagenase.
25195121 Studies indicate that the CCAAT/enhancer binding protein-epsilon (CEBPE) rs2239633 polymorphism was significantly associated with childhood acute lymphoblastic leukemiaacute lymphoblastic leukemia (ALL) risk.
25005032 Data indicate no significant associations of transcription factors rs4132601 (IKZF1), rs7089424 (ARID5B) and rs2239633 (CEBPE) with risk of pediatric non-Hodgkin lymphoma (NHL).
24497567 Germline variants in IKZF1, ARID5B, and CEBPE as risk factors for adult-onset acute lymphoblastic leukemia: an analysis from the GMALL study group.
24398327 miR-130a is important for the regulation of the timed expression of C/EBP-epsilon during granulopoiesis.
24379003 The expression profiles of transcription factors, C/EBP(alpha, beta, epsilon) and PU.1 were further evaluated in the cells after treatment with ATRA and VPA.
23836053 study found that previously identified childhood acute lymphoblastic leukemia susceptibility loci in ARID5B and CEBPE show consistent risk effects across both Hispanic and non-Hispanic White populations, providing compelling supportive evidence for susceptibility at these loci
23719191 rs2239632 could regulate the expression of the CEBPE gene. Its risk allele (G) might increase the gene product and lead to leukemogenesis. A person with the allele or the corresponding haplotype might have increased susceptibility to ALL.
23608171 rs4132601 in IKZF1 and rs2239633 in CEBPE are not significantly related to childhood childhood acute lymphoblastic leukemia.
23333304 HIV-1 Vif upregulates the expression of CCAAT/enhancer binding protein epsilon subunit (CEBPE) in Vif-expression T cells
23016962 Although germ-line SNPs in ARID5B, CEBPE, IKZF1 and CDKN2A are associated with the incidence of ALL in children, authors found no significant association between adult ALL cases and controls.
22137487 Case provides the first evidence that chromosome duplication and cryptic insertion produce the CEBPE-IGH fusion and that more than one CEBPE-IGH recombination can occur in a leukemic cell.
20661648 The results above collectively show that C/EBPepsilon participates in all-trans retinoic acid induction of PI3Kgamma.
20042726 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19684604 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19109189 Substantial quantitities of C-EBPepsilon are expressed in human neutrophils, especially the p14 and p32 variants.
18832658 C/EBP- isoforms can reprogram myeloid lineage commitment and differentiation consistent with their predicted activities based on activator and repressor domains and in vitro functional activities
18776924 ectopic expression of C/EBPepsilon, as well as C/EBPalpha, can induce the monocytic differentiation of myelomonocytic leukemic cells with MLL-fusion gene through the downregulation of Myc
17688422 C/EBP epsilon is a critical transcription factor for tumor necrosis factor alpha-induced up-regulation of phospholipid hydroperoxide glutathione peroxidase (PHGPx) expression in non-differentiated HL60 cells.
17562868 The type IV isoform of PML interacted with PU.1, promoted its association with p300, and then enhanced PU.1-induced transcription and granulocytic differentiation and PU.1 directly activates the transcription of the C/EBPepsilon gene.
17483073 the requirement for C/EBP epsilon in mediating BPI gene expression in myeloid cells in vitro and in vivo.
17347301 ATF4 may regulate myeloid gene expression differentially by potentiating C/EBPepsilon but inhibiting C/EBPalpha-mediated transcriptional activation.
17255362 Interaction of the activated NFkappaB pathway and C/EBP-epsilon may be important in selective activation of a subset of C/EBP-epsilon-responsive genes.
17244686 Decreased Gfi-1 levels in our SGD patient, together with the mutant C/EBPepsilon, block secondary granules proteins expression, thereby contributing to the underlying etiology of the disease in our patient.
16918696 Our data suggest that ATRA-induced regulation of Stat2, ICSBP and C/EBPepsilon is dependent on active Stat1, and that a failure to correctly regulate these transcription factors is associated with the inhibition of monocytic differentiation.
16788101 CCAAT/enhancer binding proteins alpha and epsilon cooperate with all-trans retinoic acid and show antitumor activity
15308577 Retinoic acid signaling in granulocytic differentiation involves regulated expression of CHOP protein and C/EBPepsilon in a coordinated fashion.
12947005 overexpression of C/EBPepsilon in myeloid cells leads to down-regulation of c-Myc
12522000 Upon induction of maturation, C/EBP epsilon binds to the lactoferrin (LF) promoter, which correlates with LF expression.
12515729 C/EBP epsilon is essential and sufficient for the expression of a particular subset of neutrophil secondary granule genes.
12393450 CEBPA and CEBPe repress the leukemic phenotype of acute myeloid leukemia, suppress cell growth, and induce partial differentiation.
12202480 Interacts with other transcription factors to regulate transcription of the gene encoding eosinophil granule major basic protein
12036869 Conditional expression of C/EBP alpha induced the C/EBP family members C/EBP beta and C/EBP epsilon and subsequent granulocyte differentiation.
11753076 causative agent in the development of Neutrophil specific granule deficiency

AA Sequence

MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLK      1 - 70
GPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNP     71 - 140
LQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLR    141 - 210
RERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGC    211 - 280
S//

Text Mined References (50)

PMID Year Title
26019275 2015 A Novel In-Frame Deletion in the Leucine Zipper Domain of C/EBP? Leads to Neutrophil-Specific Granule Deficiency.
25938438 2015 Association between CEBPE Variant and Childhood Acute Leukemia Risk: Evidence from a Meta-Analysis of 22 Studies.
25761407 2015 Association of genetic variation in IKZF1, ARID5B, and CEBPE and surrogates for early-life infections with the risk of acute lymphoblastic leukemia in Hispanic children.
25568349 2015 Acetylation of C/EBP? is a prerequisite for terminal neutrophil differentiation.
25195121 2015 CEBPE polymorphism confers an increased risk of childhood acute lymphoblastic leukemia: a meta-analysis of 11 case-control studies with 5,639 cases and 10,036 controls.
25005032 2015 Childhood acute lymphoblastic leukemia-associated risk-loci IKZF1, ARID5B and CEBPE and risk of pediatric non-Hodgkin lymphoma: a report from the Berlin-Frankfurt-Münster Study Group.
24497567 2014 Germline variants in IKZF1, ARID5B, and CEBPE as risk factors for adult-onset acute lymphoblastic leukemia: an analysis from the GMALL study group.
24398327 2014 miRNA-130a regulates C/EBP-? expression during granulopoiesis.
24379003 2014 Enhancement of differentiation induction and upregulation of CCAAT/enhancer-binding proteins and PU.1 in NB4 cells treated with combination of ATRA and valproic acid.
23996088 2013 Variation at 10p12.2 and 10p14 influences risk of childhood B-cell acute lymphoblastic leukemia and phenotype.
23836053 2013 Genetic variants in ARID5B and CEBPE are childhood ALL susceptibility loci in Hispanics.
23719191 2013 Identification of functional nucleotide and haplotype variants in the promoter of the CEBPE gene.
23608171 2013 Association of three polymorphisms in ARID5B, IKZF1 and CEBPE with the risk of childhood acute lymphoblastic leukemia in a Chinese population.
23512250 2013 Novel susceptibility variants at 10p12.31-12.2 for childhood acute lymphoblastic leukemia in ethnically diverse populations.
23016962 2012 Genetic polymorphisms in ARID5B, CEBPE, IKZF1 and CDKN2A in relation with risk of acute lymphoblastic leukaemia in adults: a Group for Research on Adult Acute Lymphoblastic Leukaemia (GRAALL) study.
22137487 2011 Double CEBPE-IGH rearrangement due to chromosome duplication and cryptic insertion in an adult with B-cell acute lymphoblastic leukemia.
22076464 2012 Identification of germline susceptibility loci in ETV6-RUNX1-rearranged childhood acute lymphoblastic leukemia.
20661648 2010 C/EBP? participates in all-trans retinoic acid induction of PI3K? in U937 cells via an intronic matrix attachment region sequence.
20042726 2010 Verification of the susceptibility loci on 7p12.2, 10q21.2, and 14q11.2 in precursor B-cell acute lymphoblastic leukemia of childhood.
19684604 2009 Loci on 7p12.2, 10q21.2 and 14q11.2 are associated with risk of childhood acute lymphoblastic leukemia.
19109189 2009 Inflammatory cytokine production by human neutrophils involves C/EBP transcription factors.
18832658 2009 Human C/EBP-epsilon activator and repressor isoforms differentially reprogram myeloid lineage commitment and differentiation.
18776924 2008 C/EBPalpha and C/EBPvarepsilon induce the monocytic differentiation of myelomonocytic cells with the MLL-chimeric fusion gene.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17688422 2007 Identification of a responsible promoter region and a key transcription factor, CCAAT/enhancer-binding protein epsilon, for up-regulation of PHGPx in HL60 cells stimulated with TNF alpha.
17562868 2007 PML-retinoic acid receptor alpha inhibits PML IV enhancement of PU.1-induced C/EBPepsilon expression in myeloid differentiation.
17483073 2007 Expression of bactericidal/permeability-increasing protein requires C/EBP epsilon.
17347301 2007 ATF4 differentially regulates transcriptional activation of myeloid-specific genes by C/EBPepsilon and C/EBPalpha.
17255362 2007 Modulation of DNA binding properties of CCAAT/enhancer binding protein epsilon by heterodimer formation and interactions with NFkappaB pathway.
17244686 2007 Growth factor independence-1 (Gfi-1) plays a role in mediating specific granule deficiency (SGD) in a patient lacking a gene-inactivating mutation in the C/EBPepsilon gene.
16918696 2006 Inhibition of monocytic differentiation by phosphorylation-deficient Stat1 is associated with impaired expression of Stat2, ICSBP/IRF8 and C/EBPepsilon.
16788101 2006 CCAAT/enhancer binding proteins alpha and epsilon cooperate with all-trans retinoic acid in therapy but differ in their antileukemic activities.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308577 2004 Retinoic acid regulates C/EBP homologous protein expression (CHOP), which negatively regulates myeloid target genes.
12947005 2004 C/EBPepsilon interacts with retinoblastoma and E2F1 during granulopoiesis.
12522000 2003 Chromatin immunoprecipitation (ChIP) studies indicate a role for CCAAT enhancer binding proteins alpha and epsilon (C/EBP alpha and C/EBP epsilon ) and CDP/cut in myeloid maturation-induced lactoferrin gene expression.
12515729 2003 Regulation of neutrophil and eosinophil secondary granule gene expression by transcription factors C/EBP epsilon and PU.1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393450 2003 CCAAT/Enhancer binding proteins repress the leukemic phenotype of acute myeloid leukemia.
12202480 2002 Novel combinatorial interactions of GATA-1, PU.1, and C/EBPepsilon isoforms regulate transcription of the gene encoding eosinophil granule major basic protein.
12161447 2002 Transcriptional activity of CCAAT/enhancer-binding proteins is controlled by a conserved inhibitory domain that is a target for sumoylation.
12036869 2002 Induction of granulocytic differentiation by 2 pathways.
11861297 2002 Macrophage functional maturation and cytokine production are impaired in C/EBP epsilon-deficient mice.
10359588 1999 Neutrophil-specific granule deficiency results from a novel mutation with loss of function of the transcription factor CCAAT/enhancer binding protein epsilon.
10233885 1999 C/EBPepsilon directly interacts with the DNA binding domain of c-myb and cooperatively activates transcription of myeloid promoters.
9177240 1997 CCAAT/enhancer binding protein epsilon is preferentially up-regulated during granulocytic differentiation and its functional versatility is determined by alternative use of promoters and differential splicing.
9032264 1997 Cloning of the novel human myeloid-cell-specific C/EBP-epsilon transcription factor.
8661101 1996 A novel human CCAAT/enhancer binding protein gene, C/EBPepsilon, is expressed in cells of lymphoid and myeloid lineages and is localized on chromosome 14q11.2 close to the T-cell receptor alpha/delta locus.
1884998 1991 A family of C/EBP-related proteins capable of forming covalently linked leucine zipper dimers in vitro.
1638120 1992 Mechanisms of liver-specific gene expression.