Property Summary

NCBI Gene PubMed Count 31
PubMed Score 13.83
PubTator Score 18.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 2.488 1.1e-02
non-small cell lung carcinoma 1.500 4.9e-10
colon cancer -4.600 5.3e-04
pancreatic cancer 2.300 1.7e-02
lung adenocarcinoma 1.200 1.2e-04
nasopharyngeal carcinoma -1.600 2.7e-04
psoriasis -1.800 1.3e-35
ulcerative colitis -2.000 1.3e-05

Gene RIF (4)

PMID Text
26323304 crystal structure of the N-terminal dimerization domain of CEACAM has been determined at 1.47 A resolution
22195770 High CEACAM7 is associated with gastric carcinoma.
20004437 CEACAM-7 expression is significantly decreased in rectal cancer; a potential tumor marker
16627067 CGM2 RT-PCR assay provides no specific prognostic information and cannot be used as a decision criterion for adjuvant therapy after colorectal cancer surgery.

AA Sequence

MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKG      1 - 70
ERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFY     71 - 140
VFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKND    141 - 210
IGPYECEIQNPVGASRSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI                   211 - 265
//

Text Mined References (32)

PMID Year Title
26323304 2015 Structure of the N-terminal dimerization domain of CEACAM7.
25152032 2014 Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) is specifically expressed in medullary thyroid carcinoma cells.
22984996 2012 Distribution of carcinoembryonic antigen-related cellular adhesion molecules in human gingiva.
22195770 2011 Dynamic expression of CEACAM7 in precursor lesions of gastric carcinoma and its prognostic value in combination with CEA.
20004437 2010 CEACAM-7: a predictive marker for rectal cancer recurrence.
19170965 2009 Contribution of intestinal epithelial cells to innate immunity of the human gut--studies on polarized monolayers of colon carcinoma cells.
18254958 2008 Transcriptomic dissection of tongue squamous cell carcinoma.
17517873 2007 Opa proteins of pathogenic neisseriae initiate Src kinase-dependent or lipid raft-mediated uptake via distinct human carcinoembryonic antigen-related cell adhesion molecule isoforms.
16755296 2006 Biomarker selection for detection of occult tumour cells in lymph nodes of colorectal cancer patients using real-time quantitative RT-PCR.
16627067 2006 Long-term prognostic value of detection of circulating colorectal cancer cells using CGM2 reverse transcriptase-polymerase chain reaction assay.
15843204 2005 Immunobead multiplex RT-PCR detection of carcinoembryonic genes expressing cells in the blood of colorectal cancer patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15194045 2004 Novel mouse model for carcinoembryonic antigen-based therapy.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14636419 2003 Interferon-gamma tempers the expression of carcinoembryonic antigen family molecules in human colon cells: a possible role in innate mucosal defence.
12824920 2003 Screening of genes specifically activated in the pancreatic juice ductal cells from the patients with pancreatic ductal carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
11331451 2001 Carcinoembryonic gene member 2 mRNA expression as a marker to detect circulating enterocytes in the blood of colorectal cancer patients.
11207550 1999 Molecular analysis of neisserial Opa protein interactions with the CEA family of receptors: identification of determinants contributing to the differential specificities of binding.
10666389 2000 Carcinoembryonic antigen family members CEACAM6 and CEACAM7 are differentially expressed in normal tissues and oppositely deregulated in hyperplastic colorectal polyps and early adenomas.
10436421 Four carcinoembryonic antigen subfamily members, CEA, NCA, BGP and CGM2, selectively expressed in the normal human colonic epithelium, are integral components of the fuzzy coat.
9533775 1998 Expression of four CEA family antigens (CEA, NCA, BGP and CGM2) in normal and cancerous gastric epithelial cells: up-regulation of BGP and CGM2 in carcinomas.
9250164 1997 Dysregulation of carcinoembryonic antigen group members CGM2, CD66a (biliary glycoprotein), and nonspecific cross-reacting antigen in colorectal carcinomas. Comparative analysis by northern blot and in situ hybridization.
9192807 1997 Expression of CD66a (human C-CAM) and other members of the carcinoembryonic antigen gene family of adhesion molecules in human colorectal adenomas.
9135022 1997 Down-regulation of carcinoembryonic antigen family member 2 expression is an early event in colorectal tumorigenesis.
7806520 1994 CGM2, a member of the carcinoembryonic antigen gene family is down-regulated in colorectal carcinomas.
2537643 1989 Analysis of the size of the carcinoembryonic antigen (CEA) gene family: isolation and sequencing of N-terminal domain exons.
1572649 1992 Long-range chromosomal mapping of the carcinoembryonic antigen (CEA) gene family cluster.
1427854 1992 Identification of three new genes and estimation of the size of the carcinoembryonic antigen family.