Property Summary

NCBI Gene PubMed Count 85
PubMed Score 244.91
PubTator Score 303.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
psoriasis -1.500 7.6e-05
osteosarcoma -6.925 6.6e-12
primary pancreatic ductal adenocarcinoma 4.991 1.2e-03
non-small cell lung cancer -1.115 2.1e-03
intraductal papillary-mucinous neoplasm ... 4.100 1.7e-02
colon cancer 1.300 2.0e-02
lung cancer -6.200 2.5e-08
active Crohn's disease 1.725 3.1e-02
active ulcerative colitis 2.658 3.1e-02
pancreatic cancer 4.800 1.6e-03
interstitial cystitis 4.400 6.8e-05
primary Sjogren syndrome 1.200 1.6e-02
invasive ductal carcinoma 1.757 2.2e-02
nasopharyngeal carcinoma -3.900 1.7e-07
lung carcinoma -5.200 5.5e-39
breast carcinoma 2.700 5.8e-23
Breast cancer 2.500 6.8e-04
ductal carcinoma in situ 5.600 8.5e-05
ovarian cancer -1.200 4.4e-04

Gene RIF (54)

PMID Text
26974538 Biliary CEACAM6 can identify patients with extrahepatic cholangiocarcinoma with a high degree of sensitivity and should be investigated further as a potential screening tool.
26673628 show the upregulation of the tumor-associated antigens CEACAM5/6 by trans-signaling of the pro-inflammatory cytokine IL-6
26483485 Data suggest ways in which carcinoembryonic antigen-related cell adhesion molecules CEACAM6 and CEACAM8 regulate the biological functions of one another.
26374831 CEACAM6 protein and mRNA were increased ~4-fold in lungs from infants with chronic lung disease as compared with controls.
26271985 Data show that carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) and forkhead box P3 (FOXP3) are associated with the malignant degree of pancreatic cancer.
25872647 vaccination with recombinant attenuated Salmonella harboring the CEACAM6 and 4-1BBL gene efficiently increased the number of CD3+CD8+ TIL and NK cells, decreased the number of FOXP3 cells and inhibited the development of DMH-induced colorectal cancer
25703140 Data indicate that carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) promotes angiogenesis in gastric cancer via focal adhesion kinase FAK signaling.
25409014 Results show that pancreatic cancer patients with CEACAM 1, 5 and 6 expression showed a significantly shortened overall survival and elevated serum values are correlated with distant metastasis suggesting a role in epithelial-mesenchymal transition.
25398131 CEACAM6 increased the levels of phosphorylated AKT, which is involved in the progression of a variety of human tumors.
25299082 CEACAM6 may be a valuable biomarker screening for gastric tumor and novel predictor for patients in advanced stages of gastric cancer
24492534 results suggested that CEACAM6 functions as an oncoprotein in gastric cancer and may be an important metastatic biomarker and therapeutic target
24231528 Data indicate that CD66c is frequently expressed in CRLF2-positive as well as hypodiploid cases.
24186057 CEACAM6 expression was expressed in different molecular subtypes of breast cancer. Among different subtypes, the highest expression was found with HER2 positive cancers.
24014076 CD66c expression appears useful only as a predictor of the Ph in adult patients (not in pediatric cases).
23857344 our findings identified CEACAM6, which is regulated by miR-29a/b/c, as an important positive regulator of EMT in pancreatic cancer
23806607 High carcinoembryonic cell adhesion molecule 6 expression is associated with malignant biliary stenoses.
23603913 CEACAM-6 plays an important role in the regulation of CD8+ T-cell responses against multiple myeloma.
23592399 these findings show that PDEF-CEACAM6 is a highly active oncogenic axis in breast cancer
23027178 The expression of CD66c was significantly higher in colorectal cancer specimens than in normal colon.
23021083 CEACAM6 is focally overexpressed in a large fraction of human HNSCCs in situ. over-expression of CEACAM6 increases tumour growth and tumour initiating activity by suppressing PI3K/AKT-dependent apoptosis of HNSCC in a xenotransplant model of HNSCC.
22975528 CEACAM6 is significantly upregulated in colon cancer tissues and is closely associated with poor prognosis.
22396546 a novel role for NA in enhancing host cell survival by activating the Src/Akt signaling axis via an interaction with carcinoembryonic antigen-related cell adhesion molecule 6/cluster of differentiation 66c (C6).
22064717 The authors show that the expression of CEACAM1 and CEACAM6 potentiate CEACAM3-dependent responses of neutrophils, exposing a cooperative role for this family of proteins during neisserial infection of neutrophils.
22037359 CEACAM6 is expressed by alveolar and airway epithelial cells of human lung and is secreted into lung-lining fluid, where fully glycosylated protein binds to surfactant.
21994005 High CEACAM6 expresssion is associated with inflammatory bowel disease.
21618249 High serum CEACAM6 is associated with gastric cancer.
21559399 Despite its important role in bacterial attachment in ileal CD, no role was detected for CEACAM6 variants in IBD susceptibility or regarding an ileal CD phenotype
21470677 The highly elevated gene expression of CEACAM6 and CEACAM8 in primary myelofibrosis can serve as molecular markers of myelofibrotic transformation.
20063526 Positivity for both leukemia-associated antigens CD66c and CD25 in combination can predict the presence of BCR/ABL rearrangement in pre-B cell acute lymphoblastic leukemia
20047061 CEACAM6 and a regulatory element near the 3' end of CEACAM3 are associated with cystic fibrosis disease severity and intrapair discordance
19411761 CEACAM6-associated signaling pathways could be potential targets for the development of biomarkers to predict the response of patients to adenovirus-based therapies, as well as for the development of more potent adenovirus-based therapeutics
19329538 Because CEACAM6 acts as an antiapoptotic factor and stabilizes surfactant function, in addition to a putative role in innate defense against bacteria, we propose that it is a multifunctional alveolar protein
19077207 Data show that desensitization of neutrophils to any two CEACAMs, 1, 3, 6, or 8, results in selective desensitization to those two CEACAMs, while the cells remain responsive to the other two neutrophil CEACAMs.
18331757 CEACAM6 is overexpressed in borderline and invasive mucinous ovarian neoplasms.
18223215 data support an important role for CEACAM6 in endocrine resistance in breast cancer, which can serve as a powerful predictor of future recurrence
17960155 Observational study of gene-disease association. (HuGE Navigator)
17909799 All the leukemic samples showed overexpression of CEACAM6 and 8 when compared with normal granulocytes.
17653079 findings suggest that CEA (CEACAM5) and CEACAM6 are major target genes for Smad3-mediated TGF-beta signaling.
17525800 CEACAM6 acts as a receptor for adherent-invasive E. coli adhesion and is abnormally expressed by ileal epithelial cells in Crohn disease.
17503391 CEACAM6 is a biological tumor marker for epithelial ovarian cancers.
17286276 CEA-mediated signaling involves clustering of CEA and co-clustering and activation of the alpha5beta1 and associated specific signaling elements on the internal surfaces of membrane microdomains
17201906 For all tumors, the amount of CEACAM6 expressed was greater than that of CEACAM5, and reflected tumor histotype.
17167768 CEA and CEACAM6 was shown to lead to an increase in the binding of the integrin alpha5beta1 receptor to its ligand fibronectin, without changing its cell surface levels, resulting in increased adhesion of CEA/CEACAM6-expressing cells to fibronectin.
16899629 The expression of CEACAM6 in ADH lesions is strongly associated with the development of IBC, therefore, it can be applied as a diagnostic marker either singly or in combination with other marker(s) to predict IBC development in women with ADH lesions.
16115956 Data show that variants of Neisseria gonorrhoeae that bind to human carcinoembryonic antigen-related cell adhesion molecules (CEACAMs) 1 and 6 failed to induce detachment and, instead, promoted enhanced host cell adhesion to the ECM.
15826304 CD66c is regulated in a manner distinct from other myeloid antigens in childhood lymphoblastic leukemia
15316565 Levels of CEACAM6 expression can modulate pancreatic adenocarcinoma cellular invasiveness in a c-Src-dependent manner
15208677 CEACAM6 is an important determinant of pancreatic adenocarcinoma malignant cellular behavior
15130118 the results show that recognition of CEA and CEACAM6, but not CEACAM1, is accompanied by tight attachment to bacteria of cell surface microvilli-like extensions
15081416 overexpression among human malignancies, immunological targeting of this tumor antigen may have therapeutic applicability
14724575 CEACAM6 gene silencing reversed the acquired anoikis resistance of tumor cell lines and inhibited in vivo metastatic ability
14512395 the first study to demonstrate the prognostic relevance of CEACAM6 overexpression in human colorectal cancer
12571231 CEACAM6 subdomains involved in intercellular adhesion activity and subdomains involved in inhibition of cell differentation are identified and their respective activities are independently blocked.
11896570 Overexpression of CEACAM6 disrupts tissue architecture and blocks colonocyte differentiation

AA Sequence

MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKG      1 - 70
ERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHV     71 - 140
YPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDA    141 - 210
GSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQS    211 - 280
TQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI          281 - 344
//

Text Mined References (89)

PMID Year Title
26974538 2016 The Role of Biliary Carcinoembryonic Antigen-Related Cellular Adhesion Molecule 6 (CEACAM6) as a Biomarker in Cholangiocarcinoma.
26673628 2015 Interleukin-6 trans-signaling increases the expression of carcinoembryonic antigen-related cell adhesion molecules 5 and 6 in colorectal cancer cells.
26483485 2015 Diverse oligomeric states of CEACAM IgV domains.
26374831 2015 Expression of Carcinoembryonic Cell Adhesion Molecule 6 and Alveolar Epithelial Cell Markers in Lungs of Human Infants with Chronic Lung Disease.
26271985 2015 [The effects of CEACAM6 and FOXP3 on tumor infiltrating lymphocytes and prognosis in patients with pancreatic cancer].
25872647 2015 Recombinant Salmonella-based CEACAM6 and 4-1BBL vaccine enhances T-cell immunity and inhibits the development of colorectal cancer in rats: In vivo effects of vaccine containing 4-1BBL and CEACAM6.
25703140 2015 CEACAM6 promotes tumor angiogenesis and vasculogenic mimicry in gastric cancer via FAK signaling.
25645918 2015 Human neutrophils secrete bioactive paucimannosidic proteins from azurophilic granules into pathogen-infected sputum.
25409014 2014 Carcinoembryonic antigen-related cell adhesion molecules (CEACAM) 1, 5 and 6 as biomarkers in pancreatic cancer.
25398131 2014 CEACAM6 promotes gastric cancer invasion and metastasis by inducing epithelial-mesenchymal transition via PI3K/AKT signaling pathway.
25299082 2014 Expression profiling of CEACAM6 associated with the tumorigenesis and progression in gastric adenocarcinoma.
25171863 2014 MicroRNA-29a suppresses the growth, migration, and invasion of lung adenocarcinoma cells by targeting carcinoembryonic antigen-related cell adhesion molecule 6.
24735478 2014 Signaling by epithelial members of the CEACAM family - mucosal docking sites for pathogenic bacteria.
24697191 2014 Transcriptional changes in organoculture of full-thickness human skin following topical application of all-trans retinoic acid.
24655379 2014 A marker of endocrine receptor-positive cells, CEACAM6, is shared by two major classes of breast cancer: luminal and HER2-enriched.
24492534 2014 CEACAM6 promotes tumor migration, invasion, and metastasis in gastric cancer.
24326999 2014 Influences of enteral nutrition upon CEACAM6 expression by intestinal epithelial cells.
24303032 2013 Prioritization of cancer marker candidates based on the immunohistochemistry staining images deposited in the human protein atlas.
24231528 2014 Significance of CD66c expression in childhood acute lymphoblastic leukemia.
24186057 2013 Expression and clinical significance of carcinoembryonic antigen-related cell adhesion molecule 6 in breast cancers.
24045095 2013 Dysregulation of the epigenome in triple-negative breast cancers: basal-like and claudin-low breast cancers express aberrant DNA hypermethylation.
24014076 2013 Adult and pediatric cases of B-cell lymphoblastic leukemia differ in the clinical significance of CD66c expression.
23941132 2013 Carcinoembryonic antigen (CEA)-related cell adhesion molecules are co-expressed in the human lung and their expression can be modulated in bronchial epithelial cells by non-typable Haemophilus influenzae, Moraxella catarrhalis, TLR3, and type I and II interferons.
23857344 2013 CEACAM6 induces epithelial-mesenchymal transition and mediates invasion and metastasis in pancreatic cancer.
23806607 2014 Bile carcinoembryonic cell adhesion molecule 6 (CEAM6) as a biomarker of malignant biliary stenoses.
23603913 2013 Tumor cells in multiple myeloma patients inhibit myeloma-reactive T cells through carcinoembryonic antigen-related cell adhesion molecule-6.
23592399 2013 Prostate derived Ets transcription factor and Carcinoembryonic antigen related cell adhesion molecule 6 constitute a highly active oncogenic axis in breast cancer.
23027178 2013 CD66c is a novel marker for colorectal cancer stem cell isolation, and its silencing halts tumor growth in vivo.
23021083 2012 Focal overexpression of CEACAM6 contributes to enhanced tumourigenesis in head and neck cancer via suppression of apoptosis.
22975528 2013 Overexpression and clinical significance of carcinoembryonic antigen-related cell adhesion molecule 6 in colorectal cancer.
22396546 2012 Influenza A virus neuraminidase protein enhances cell survival through interaction with carcinoembryonic antigen-related cell adhesion molecule 6 (CEACAM6) protein.
22064717 2012 Defining the roles of human carcinoembryonic antigen-related cellular adhesion molecules during neutrophil responses to Neisseria gonorrhoeae.
22037359 2012 Distribution and surfactant association of carcinoembryonic cell adhesion molecule 6 in human lung.
21994005 2012 Characterization of adherent-invasive Escherichia coli isolated from pediatric patients with inflammatory bowel disease.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21618249 2011 Expression and prognostic significance of CEACAM6, ITGB1, and CYR61 in peripheral blood of patients with gastric cancer.
21559399 2011 CEACAM6 gene variants in inflammatory bowel disease.
21470677 2011 High expression of carcinoembryonic antigen-related cell adhesion molecule (CEACAM) 6 and 8 in primary myelofibrosis.
20063526 Expression of CD66c and CD25 in acute lymphoblastic leukemia as a predictor of the presence of BCR/ABL rearrangement.
20047061 2010 Hierarchical fine mapping of the cystic fibrosis modifier locus on 19q13 identifies an association with two elements near the genes CEACAM3 and CEACAM6.
19411761 2009 CEACAM6 attenuates adenovirus infection by antagonizing viral trafficking in cancer cells.
19329538 2009 Carcinoembryonic cell adhesion molecule 6 in human lung: regulated expression of a multifunctional type II cell protein.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19077207 2008 Interdependency of CEACAM-1, -3, -6, and -8 induced human neutrophil adhesion to endothelial cells.
18331757 2008 Overexpression of CEACAM6 in borderline and invasive mucinous ovarian neoplasms.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18223215 2008 Carcinoembryonic antigen cell adhesion molecule 6 predicts breast cancer recurrence following adjuvant tamoxifen.
17960155 2008 Haplotypic diversity in human CEACAM genes: effects on susceptibility to meningococcal disease.
17909799 2008 High expression of CEACAM6 and CEACAM8 mRNA in acute lymphoblastic leukemias.
17653079 2008 CEACAM5 and CEACAM6 are major target genes for Smad3-mediated TGF-beta signaling.
17525800 2007 CEACAM6 acts as a receptor for adherent-invasive E. coli, supporting ileal mucosa colonization in Crohn disease.
17503391 2006 Biomarkers for epithelial ovarian cancers.
17286276 2007 A co-clustering model involving alpha5beta1 integrin for the biological effects of GPI-anchored human carcinoembryonic antigen (CEA).
17201906 2007 Expression patterns of CEACAM5 and CEACAM6 in primary and metastatic cancers.
17167768 2007 GPI-anchored CEA family glycoproteins CEA and CEACAM6 mediate their biological effects through enhanced integrin alpha5beta1-fibronectin interaction.
16899629 2006 Expression of carcinoembryonic antigen cell adhesion molecule 6 oncoprotein in atypical ductal hyperplastic tissues is associated with the development of invasive breast cancer.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16115956 2005 CEACAM engagement by human pathogens enhances cell adhesion and counteracts bacteria-induced detachment of epithelial cells.
15826304 2005 Myeloid antigens in childhood lymphoblastic leukemia: clinical data point to regulation of CD66c distinct from other myeloid antigens.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15316565 2004 CEACAM6 is a determinant of pancreatic adenocarcinoma cellular invasiveness.
15208677 2004 Overexpression of CEACAM6 promotes insulin-like growth factor I-induced pancreatic adenocarcinoma cellular invasiveness.
15130118 2004 Differential recognition of members of the carcinoembryonic antigen family by Afa/Dr adhesins of diffusely adhering Escherichia coli (Afa/Dr DAEC).
15081416 2004 CEACAM6 as a novel target for indirect type 1 immunotoxin-based therapy in pancreatic adenocarcinoma.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14724575 2004 CEACAM6 gene silencing impairs anoikis resistance and in vivo metastatic ability of pancreatic adenocarcinoma cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14512395 2003 Expression of CEACAM6 in resectable colorectal cancer: a factor of independent prognostic significance.
12571231 2003 The adhesion and differentiation-inhibitory activities of the immunoglobulin superfamily member, carcinoembryonic antigen, can be independently blocked.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12005421 2001 Synthetic peptides from the N-domains of CEACAMs activate neutrophils.
11994468 2002 Carcinoembryonic antigen-related cell adhesion molecule 1 expression and signaling in human, mouse, and rat leukocytes: evidence for replacement of the short cytoplasmic domain isoform by glycosylphosphatidylinositol-linked proteins in human leukocytes.
11095950 2000 Extracellular N-domain alone can mediate specific heterophilic adhesion between members of the carcinoembryonic antigen family, CEACAM6 and CEACAM8.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10666389 2000 Carcinoembryonic antigen family members CEACAM6 and CEACAM7 are differentially expressed in normal tissues and oppositely deregulated in hyperplastic colorectal polyps and early adenomas.
9266023 1997 Hair cycle-dependent expression of a nonspecific cross reacting antigen (NCA)-50/90-like molecule on follicular keratinocytes.
8018919 1994 CD66 identifies the biliary glycoprotein (BGP) adhesion molecule: cloning, expression, and adhesion functions of the BGPc splice variant.
3619891 1987 Molecular cloning of a gene for a member of carcinoembryonic antigen (CEA) gene family; signal peptide and N-terminal domain sequences of nonspecific crossreacting antigen (NCA).
3527416 1986 Distribution of surface nonspecific cross-reacting antigen and influence of proteolytic enzymes on this antigen in myeloid cell series.
3337731 1988 Primary structure of nonspecific crossreacting antigen (NCA), a member of carcinoembryonic antigen (CEA) gene family, deduced from cDNA sequence.
3220478 1988 Carcinoembryonic antigen family: characterization of cDNAs coding for NCA and CEA and suggestion of nonrandom sequence variation in their conserved loop-domains.
3128509 1988 The molecular heterogeneity of nonspecific cross-reacting antigen synthesized by tumor cells and granulocytes.
2830274 1988 Characterization of a cDNA clone for the nonspecific cross-reacting antigen (NCA) and a comparison of NCA and carcinoembryonic antigen.
2612212 1989 Regional assignment of nonspecific cross-reacting antigen (NCA) of the CEA gene family to chromosome 19 at band q13.2.
2341397 1990 Sequence and glycosylation site identity of two distinct glycoforms of nonspecific cross-reacting antigen as demonstrated by sequence analysis and fast atom bombardment mass spectrometry.
2332039 1990 Prognostic significance of secondary cytogenetic changes and nonspecific cross-reacting antigen (NCA) in patients with Ph-positive chronic myeloid leukemia.
2022629 1991 A specific heterotypic cell adhesion activity between members of carcinoembryonic antigen family, W272 and NCA, is mediated by N-domains.