Property Summary

NCBI Gene PubMed Count 31
PubMed Score 15.41
PubTator Score 8281.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 7.8e-17
osteosarcoma 7933 6.1e-06
non primary Sjogren syndrome sicca 840 1.5e-02
Disease Target Count Z-score Confidence
Gonorrhea 14 3.446 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.364 6.1e-06
non primary Sjogren syndrome sicca 1.100 1.5e-02
psoriasis 1.900 7.8e-17

Gene RIF (21)

PMID Text
26556959 Demonstrated the CEACAM3 specificity and a perioperative trend of circulating tumor cells which is coherent with the clinical/pathological considerations in colorectal cancer.
26162539 COLIV is a promising tumour marker for CLM and can possibly be used to detect postoperative CLM recurrence. The combination of COLIV and CEA is superior to either marker alone in detecting CLM
23630956 A failure of CEACAM3-mediated innate immune detection might be linked to the ability of gonococci to cause disseminated infections.
22948154 Grb14 is the first negative regulator of CEACAM3-initiated bacterial phagocytosis and might help to focus granulocyte responses to the subcellular sites of pathogen-host cell contact
22469950 CEACAM3 promotes opsonin-independent phagocytosis of CEACAM-binding bacteria. CEACAM3 is the main driver for this process on human granulocytes.
22382453 The higher expression of CD44v6, integrin-beta1, CA199, and CEA are closely related to the progression and metastasis of pancreatic cancer.[CA199, CD44v6]
22064717 The authors show that the expression of CEACAM1 and CEACAM6 potentiate CEACAM3-dependent responses of neutrophils, exposing a cooperative role for this family of proteins during neisserial infection of neutrophils.
21216968 the ability of CEACAM3 to coordinate signaling events that not only mediate bacterial uptake, but also trigger the killing of internalized pathogens.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20373053 the prognostic value of preoperative serum carbohydrate antigen19-9, carcinoembryonic antigen, and carbohydrate antigen 125 for overall survival in patients with colorectal cancer was studied
20071292 CA-19.9 serum tumor marker levels retain independent prognostic value for poor survival in patients with advanced pancreatic cancer.
20047061 CEACAM6 and a regulatory element near the 3' end of CEACAM3 are associated with cystic fibrosis disease severity and intrapair discordance
19089662 Increased CA 19-9 level is associated with pancreatic adenocarcinoma and cholangiocarcinoma.
19077207 Data show that desensitization of neutrophils to any two CEACAMs, 1, 3, 6, or 8, results in selective desensitization to those two CEACAMs, while the cells remain responsive to the other two neutrophil CEACAMs.
17878338 killing of bulk NK cultures was inhibited by CEA-expressing cells, suggesting that this putative receptor is an inhibitory receptor
17506820 These data reveal CEACAM3 as a specific innate immune receptor that mediates the opsonin-independent clearance of CEACAM-binding bacteria via Syk, a molecular trigger for functional immunoreceptor responses of both the adaptive and innate immune systems.
17413979 Our results suggest that an immunohistochemical panel consisting of TTF-1, CEA, CA-125, and OCT-4 is helpful in distinguishing most pulmonary and ovarian carcinomas with clear cell features.
17211733 Increased p53, CEA, and CA 19-9 serum levels are associated with colorectal cancer.
17071045 Molecular staging of SLN using real-time RT-PCR for early breast cancer could serve as a useful complement to standard clinicopathological risk factors.
14707113 CEACAM3 controls human-specific pathogens by the innate immune system.
12571236 CEACAM3 has a role in internalizing bacteria to epithelial cells

AA Sequence

MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKG      1 - 70
ERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHV     71 - 140
YQENAPGLPVGAVAGIVTGVLVGVALVAALVCFLLLAKTGRTSIQRDLKEQQPQALAPGRGPSHSSAFSM    141 - 210
SPLSTAQAPLPNPRTAASIYEELLKHDTNIYCRMDHKAEVAS                                211 - 252
//

Text Mined References (33)

PMID Year Title
26556959 2015 The Trend of CEACAM3 Blood Expression as Number Index of the CTCs in the Colorectal Cancer Perioperative Course.
26162539 2015 Improved tumour marker sensitivity in detecting colorectal liver metastases by combined type IV collagen and CEA measurement.
23630956 2013 Innate recognition by neutrophil granulocytes differs between Neisseria gonorrhoeae strains causing local or disseminating infections.
22948154 2012 Grb14 is a negative regulator of CEACAM3-mediated phagocytosis of pathogenic bacteria.
22469950 2012 HemITAM signaling by CEACAM3, a human granulocyte receptor recognizing bacterial pathogens.
22382453 2012 The efficacy evaluation of cryosurgery in pancreatic cancer patients with the expression of CD44v6, integrin-?1, CA199, and CEA.
22064717 2012 Defining the roles of human carcinoembryonic antigen-related cellular adhesion molecules during neutrophil responses to Neisseria gonorrhoeae.
21216968 2011 Phosphatidylinositol 3'-kinase activity is critical for initiating the oxidative burst and bacterial destruction during CEACAM3-mediated phagocytosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20373053 2011 Preoperative serum carbohydrate antigen 125 level is an independent negative prognostic marker for overall survival in colorectal cancer.
20071292 2009 CEA and CA-19.9 serum tumor markers as prognostic factors in patients with locally advanced (unresectable) or metastatic pancreatic adenocarcinoma: a retrospective analysis.
20047061 2010 Hierarchical fine mapping of the cystic fibrosis modifier locus on 19q13 identifies an association with two elements near the genes CEACAM3 and CEACAM6.
19089662 2007 CA 19-9 and survival in advanced and unresectable pancreatic adenocarcinoma and cholangiocarcinoma.
19077207 2008 Interdependency of CEACAM-1, -3, -6, and -8 induced human neutrophil adhesion to endothelial cells.
17878338 2007 Intercellular transfer of carcinoembryonic antigen from tumor cells to NK cells.
17506820 2007 The specific innate immune receptor CEACAM3 triggers neutrophil bactericidal activities via a Syk kinase-dependent pathway.
17413979 2007 Carcinomas of ovary and lung with clear cell features: can immunohistochemistry help in differential diagnosis?
17211733 2007 Comparative analysis of predictive biomarkers for therapeutical strategies in colorectal cancer.
17071045 2007 Correlation between molecular metastases in sentinel lymph nodes of breast cancer patients and St Gallen risk category.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14707113 2004 Granulocyte CEACAM3 is a phagocytic receptor of the innate immune system that mediates recognition and elimination of human-specific pathogens.
12864848 2003 Immunoreceptor tyrosine-based activation motif phosphorylation during engulfment of Neisseria gonorrhoeae by the neutrophil-restricted CEACAM3 (CD66d) receptor.
12571236 2003 Phosphatidylinositol 3-kinases in carcinoembryonic antigen-related cellular adhesion molecule-mediated internalization of Neisseria gonorrhoeae.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12005421 2001 Synthetic peptides from the N-domains of CEACAMs activate neutrophils.
11708798 2001 The microbial receptor CEACAM3 is linked to the calprotectin complex in granulocytes.
8699114 1996 CD66a, CD66b, CD66c, and CD66d each independently stimulate neutrophils.
8508798 1993 Genomic organization, splice variants and expression of CGM1, a CD66-related member of the carcinoembryonic antigen gene family.
2537643 1989 Analysis of the size of the carcinoembryonic antigen (CEA) gene family: isolation and sequencing of N-terminal domain exons.
2050678 1991 Molecular cloning of nonspecific cross-reacting antigens in human granulocytes.
1427854 1992 Identification of three new genes and estimation of the size of the carcinoembryonic antigen family.