Property Summary

NCBI Gene PubMed Count 186
PubMed Score 343.34
PubTator Score 364.52

Knowledge Summary

Patent

No data available

Expression

Gene RIF (155)

PMID Text
27074014 Osteosarcoma patients with higher CEACAM1 had relatively lower survival compared to those with low CEACAM1 and high serum CEACAM1 level was an independent prognostic factor for osteosarcoma
26688824 serum CEACAM1 is elevated over time in progressive melanoma patients who fail to respond to immunotherapy as opposed to responders and stable disease patients.
26653024 CEACAM1 might play an important role in ovarian tumor progression, especially in tumor metastasis
26646010 Collectively, these data suggest that vIL-6 modulates endothelial cell migration by upregulating the expression of cellular factors, including CEACAM1.
26343926 Serum concentrations of CEACAM1 may serve as a useful indicator for the presence of breast cancer
26341981 Taken together, our results demonstrate a systematic down-regulation of CEACAM1 in breast cancer and suggest that a strategy to restore CEACAM1 expression may be helpful for the treatment of breast cancer.
26301891 an MITF-CEACAM1 axis is suggested as a potential determinant of melanoma progression.
26238781 Ceacam1L acts as a crucial factor in glioblastoma-initiating cell maintenance and tumorigenesis by activating c-Src/STAT3 signaling. Monomers of the cytoplasmic domain of Ceacam1L bound to c-Src and STAT3 and induced their phosphorylation.
26107193 High Carcinoembryonic Antigen expression is associated with colon and stomach cancer.
26081722 CEACAM1 mediates bacterial adherence and transcellular transcytosis.
25987051 High levels of serum CEA, CA72-4, CA19-9 and TSGF are associated with Gastric Cancer.
25987049 High carcinoembryonic antigen serum levels are associated with Lung Adenocarcinoma.
25824372 our data show that human and bovine CEACAM1 can both inhibit NK-cell cytotoxicity although they differ in their intracellular signaling motifs
25744717 CEACAM1-4L downregulated cell surface levels of the NKG2D ligands.
25582745 Elevated carcinoembryonic antigen expression is associated with recurrence for patients after resection for colorectal liver metastases.
25575053 CEACAM1 gene silencing inhibited the cell proliferation and promote the apoptosis in human glioma SHG44 cells.
25551300 CD66 is a potential tumor marker to differentiate lung adenocarcinoma-associated malignant pleural effusion from benign effusions.
25547406 CEACAM1 long cytoplasmic domain isoform dominance is associated with chemoresistance
25409014 Results show that pancreatic cancer patients with CEACAM 1, 5 and 6 expression showed a significantly shortened overall survival and elevated serum values are correlated with distant metastasis suggesting a role in epithelial-mesenchymal transition.
25368272 High serum carcinoembryonic antigen level is associated with cholangiocarcinoma.
25363763 CEACAM1 serves as a heterophilic ligand for TIM-3 that is required for its ability to mediate T-cell inhibition, and this interaction has a crucial role in regulating autoimmunity and anti-tumour immunity
24931667 CEACAM1 increases the expression of Sox-2, which we show to be responsible for the CEACAM1-mediated enhanced proliferation of melanoma cells
24846314 The up-regulation of CEACAM1 expression in gastric adenocarcinoma may participate in tumorous angiogenesis, especially high expression of CEACAM1 promoted its capability of invasion and metastasis.
24743304 CEACAM8 interacts with CEACAM1 inhibiting TLR2-triggered immune responses
24716460 Abnormal expression of CD66a promotes proliferation and inhibits apoptosis of human leukemic B cells in vitro
24650050 we provide evidence that CEACAM1's promoter and variable exon 7 cross-talk allowing IRF-1 to direct alternative splicing events
24587171 Our results demonstrated that more neutrophils infiltration and overexpression of CEACAM1 were associated with poor clinical outcomes in TSCC tissues.
24518592 Among the 273 upregulated genes in the atypical vs typical subtype, GC (vitamin D-binding protein) and CEACAM1 (carcinoembryonic antigen family member) emerged as potent diagnostic markers.
24390710 In conclusion, CEACAM1-L isoform expression dominance is associated with invasion, metastasis, and recurrence in hepatocellular carcinoma.
24302721 CaMKIID specifically phosphorylates Thr-457 on CEACAM1-SF, which in turn regulates the process of lumen formation via apoptosis of the central acinar cells.
24072270 Elevated serum CA 15-3 and CEA levels at recurrence suggest increased tumor burden and may be prognostic for survival for metastatic breast cancer patients.
24005674 Results indicate that a dynamic oligomer-to-monomer shift in surface-expressed CEACAM1 facilitates trans-homophilic binding and downstream effector signaling.
23992005 High serum carcinoembryonic antigen expression is associated with lung cancer.
23991991 High carcinoembryonic antigen expression is associated with colorectal and gastric cancer.
23991977 Low Carcinoembryonic Antigen expression is associated with response to therapy in advanced non-small-cell lung cancer.
23933369 Overall, these data indicate that expression of human CEACAM1 confers a reduced Opa-specific antibody response in vivo without affecting the overall immune response against other Outer membrane vesicle antigens.
23898208 HIV-1 Tat upregulates the expression of carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) in human primary T cells
23894299 increased surface expression of the co-inhibitory immune receptor CEACAM1 in late-onset neonatal sepsis
23886200 High carcinoembryonic antigen expression is associated with lymph node metastasis in colon cancer.
23885995 CEACAM1 might be a useful marker in early diagnosis of non-small-cell lung carcinoma
23780386 CEACAM1 controls matrix metalloproteinase-9 secretion by neutrophils in postischemic inflammation at the blood brain barrier after stroke.
23760586 Elevated preoperative CEA concentration is associated with recurrence after curative resection in patients with stage IIA colorectal cancer.
23651919 Here we report for the first time that CEACAM1 is expressed ontogenetically in oligodendrocytes of the developing rat brain
23499736 CEACAM1 regulates Fas-mediated apoptosis in Jurkat T-cells via its interaction with beta-catenin.
23452434 High serum Carcinoembryonic Antigen is associated with recurrence in rectal cancer.
23358633 conclude that CEACAM20 and CEACAM1 not only mark the lumina of adult prostate tissue but also play a critical role in the vitro generation of prostate organoids
23349235 role in mutual stimulation of chemotactic migration between trophoblast and endometrial stromal cells
23319418 CEACAM1 inhibits both G-CSF production by myeloid cells and G-CSF-stimulated tumor angiogenesis
23243275 Studies suggest that Am80 promote bactericidal activities probably through coordinating the functional interaction of CD66 with CD18 to enhance the development of neutrophil immunity during granulopoiesis.
23219815 These results indicated that CEACAM1 was an inhibitor of cell-matrix adhesion
23038226 This is the first report to demonstrate the loss of CEACAM1 expression in hereditary CRC.
23010737 Elevated Carcinoembryonic Antigen is associated with incomplete response to chemoradiation in patients with rectal cancer.
22932077 Loss of membranous CEACAM1 expression in HCC was closely associated with aggressive tumor biology and might be a relapsing biomarker of HCC treated with liver transplantation.
22922158 In this review the role of CEACAM3 in neutrophil activation and its initiation of phagocytosis as a result of binding to bacterial Opa protein is discussed.
22751559 Restoration of CEACAM1 expression in tumor cell lines often abolishes their oncogenicity. De novo expression of CEACAM1 is found with the progression of malignancy and metastatic spread in a large array of cancer tissues. Review.
22482415 Data show that the higher expression of HBx and lower expression of CEACAM1 are correlated with invasion and metastasis of HBV related hepatocelular carcinoma.
22209504 SOX9 expression increased from gastric nonneoplastic to neoplastic lesions and CEACAM1 expression patterns changed; their coexpression was also elevated, suggesting that SOX9 plays important roles in changing CEACAM1 expression and in tumor progression.
22162753 CEACAM specific T84.1 antibody binds to tumour cells in the vicinity of blood vessels
22143889 CEACAM1 dampens antitumor immunity by down-regulating NKG2D ligand expression on tumor cells.
22135912 The prognosis of the patients with low CEACAM1 expression and high tumor pathological grade were poorer than those patients with high expression and low pathological grade, P < 0.05. Clinically.
22088515 SCC, CEA, Cyfra 21-1 and NSE are valuable in the early diagnosis of lung cancer among suspicious nodules in the lung, especially when they were assayed together for one patient.
22064717 The authors show that the expression of CEACAM1 and CEACAM6 potentiate CEACAM3-dependent responses of neutrophils, exposing a cooperative role for this family of proteins during neisserial infection of neutrophils.
21695697 High Carcinoembryonic Antigen expression is associated with recurrence in gastric cancer.
21671129 upregulated expression plays role in the immunopathogenesis of oral lichen planusr
21569294 These data supports that a decreased CEACAM1 expression is related to obesity and a fatty liver.
21487066 Data suggest that plasma markers: CEACAM, ICAM-1, osteopontin, MIA, TIMP-1 and S100B particularly when assessed in combination, can be used to monitor patients for disease recurrenc.
21413011 CEACAM1-L dominance is important for colorectal cancer cells invasion and migration.
21398516 Mechanistic control of carcinoembryonic antigen-related cell adhesion molecule-1 (CEACAM1) splice isoforms by the heterogeneous nuclear ribonuclear proteins hnRNP L, hnRNP A1, and hnRNP M.
21298042 a mechanistically distinct Opa protein-independent interaction between Neisseria meningitidis and human CEACAM1.
21106423 from benign to premalignant and malignant lesions, CEACAM1 expression patterns are transformed
21050451 Data suggest that transcription activators USF1 and IRF1 interact to modulate CEACAM1 expression and that the chromatin structure of the promoter is likely maintained in a poised state that can promote rapid induction under appropriate conditions.
20737948 CEACAM-1 and CXCL-14 are involved in the occurrence and development of infantile hemangioma.
20682994 CEACAM1 is not present in the majority of adenomatoid tumor blood vessels, which might be related to the lower angiogenic activity and benign behaviour of this tumor.
20524097 genetic alteration and loss of expression of the CEACAM1 may contribute to the development of colorectal cancers, as an early event.
20406467 These results establish the selective interaction of several human-restricted bacterial pathogens with human CEACAM1.
20305326 Observational study of gene-disease association. (HuGE Navigator)
20090913 data suggest that post-confluent contact inhibition is established and maintained by CEACAM1-4L, but disturbances of CEACAM1 signalling by CEACAM1-4S and other CEACAMs lead to undifferentiated cell growth and malignant transformation
20034698 The Le(x) residues of both, CEACAM1 and CEA, interact with the human Le(x)-binding glycan receptors DC-SIGN and SRCL.
19948502 CEACAM1 transmembrane signaling is initiated by adhesion-regulated changes of cis-interactions that are transmitted to the inner phase of the plasma membrane.
19720754 while Opa proteins of N. meningitidis can bind to T-cell-expressed CEACAM1, this is not sufficient to overcome the T-cell recognition of bacterial factors
19633846 this study is about the systemic involvement of CEACAM1 in melanoma patients, including serum CEACAM1 concentrations as well as CEACAM1 expression on circulating lymphocytes.
19545674 Up-regulated expression of CEACAM1 in tubular and/or glomerular cells is an indicator of acute inflammatory processes in biopsy specimens from patients with acute renal allograft rejections.
19487071 Urinary CEACAM1 levels discriminate bladder urothelial carcinoma patients from control subjects. Moreover, urinary levels of CEACAM1 increased with advancing stage and grade.
19461083 expression of CEACAM1 in melanomas and primary superficial spreading melanoma was significantly increased.
19454653 Similar to its function in T cells, CEACAM1 may act as an inhibitory B cell coreceptor, most likely through recruitment of SHP-1 and inhibition of a PI3K-promoted activation pathway.
19442569 Membranous CEACAM1 inhibits angiogenesis and lymphangiogenesis, but cytoplasmic CEACAM1 promotes angiogenesis, and even promotes lymphangiogenesis by mediating the transformation of vascular endothelial cells (VECs) into lymphatic endothelial cells (LECs)
19407471 Repression of CEACAM1 could contribute to cancer progression and may indicate a poor prognosis for patients with oral squamous cell carcinoma
19361387 CEACAM1 is an important regulator of lipid metabolism, of tumor progression as a regulator of the Wnt signaling pathway, of normal and tumor neo-angiogenesis and of immunity.
19349857 PETs showing CEACAM1 positivity have a statistically significant correlation with several of the pathologic parameters of aggressive behavior and its overexpression is seen in those cases with increased invasiveness.
19243897 Report different expression of carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) and possible roles in gastric carcinomas.
19146852 findings suggest that both Thr-457 and Ser-461 are key residues involved in lumen formation of CEACAM1-4L
19077207 Data show that desensitization of neutrophils to any two CEACAMs, 1, 3, 6, or 8, results in selective desensitization to those two CEACAMs, while the cells remain responsive to the other two neutrophil CEACAMs.
19020551 Carcinoembryogenic antigen-related cell adhesion molecule (CEACAM)-1 and the urokinase plasminogen activator (uPA)/uPA-receptor (uPAR) pathway were identified as possible mediators in HGF-induced keratinocyte migration.
18843289 cytokine-induced cell-surface expression of CEACAM1 by keratinocytes in the context of a psoriatic environment might contribute to the persistence of neutrophils and thus to ongoing inflammation
18836450 This finding is of particular interest, as it identifies a strategy by which bacteria 'use' CEACAM1 to colonize the pulmonary epithelium.
18794798 CEACAM1 is a direct target of SOX9 in the colon epithelium
18705345 Micrometastases of gastric cancer can be detected in circulating peripheral blood using quantitative real-time RT-PCR. CK19 is a better marker than CK18, CK20 and CEA
18507857 network of regulatory elements control the alternative splicing of CEACAM1
18497748 This explains how UspA1 can engage CEACAM1 at a site far distant from its head group, permitting closer proximity of the respective cell surfaces during infection.
18453603 bacteria effectively harness the coinhibitory function of CEACAM1 to suppress the adaptive immune response at its earliest step.
18445773 There is a functional role for the long cytoplasmic domain of CEACAM1 in regulation of beta-catenin activity.
18424730 CEACAM1 orchestrate an inhibitory program that abrogates extremely proximal events downstream of the TCR/CD3 complex by focusing on the activation of ZAP-70.
18278069 CEACAM1-dependent cell death pathway involves dual cleavage of CEACAM1 and caspase activation and can be activated by CEA.
18215438 high CEACAM-1 expression is associated with an increased angiogenic activity in non-small-cell lung cancer and that the prognostic influence of CEACAM-1 might be derived from this association
18081725 These data argue for a functional role of lipid rafts in CEACAM1-mediated endocytosis that is promoted by the transmembrane domain of the receptor and that might be relevant for CEACAM1 function in physiologic settings.
17979980 It is reported here that hCEACAM1-4L has a key function in downregulating the protein tyrosine Src kinase associated with hDAF signalling.
17960155 Haplotypic diversity in CEACAM genes: effects on susceptibility to meningococcal disease.
17960155 Observational study of gene-disease association. (HuGE Navigator)
17764466 The studies demonstrate the importance of CEACAMs as mediators of increased cellular invasion under conditions of inflammation and bring to light the potential role of NFkappaB pathway in Opa-mediated invasion by meningococci.
17761831 interaction of CEACAM1 with Prox1 and VEGFR-3 plays a crucial role in tumor lymphangiogenesis and reprogramming of vascular endothelial cells to lymphatic endothelial cells
17623671 PDIP38 can shuttle between the cytoplasmic and the nuclear compartments and that its subcellular localization is regulated by CEACAM1
17620353 Meningococcal outer membrane vesicle (OMV)preparations bind the immunoreceptor tyrosine-based inhibitory motif-containing coinhibitory receptor CEACAM1 and inhibit T-cell activation and proliferation.
17612570 data reveal the dual role of CEACAM1 on hepatocarcinogenesis; CEACAM1 acts as tumor suppressor in HepG2 cells in anchorage-depend. growth conditions; in anchorage-independent growth cond it augments cell proliferation by potentiating cell-cell attachment.
17605118 Epithelial downregulation of CEACAM1 in superficial bladder tumors and in PIN of the prostate. Concurrently, CEACAM1 is upregulated in endothelial cells of tumor blood vessels.
17546042 Phosphorylation mimic mutants at either Thr457 or Ser459 (or both), but not null mutants in CEACAM1-4S were able to restore glandular lumen formation.
17471435 In conclusion, M. catarrhalis induced apoptosis in pulmonary epithelial cells--a process that was triggered by interaction between CEACAM1 and UspA1.
17143599 High expression of CD66a was significantly correlated with tumor invasion, stage, and pre-operation serum carcinoembryonic antigen level.
17071610 CEACAM1 functions as a key regulator of contact-dependent control of cell survival, differentiation, and growth by controlling both ERK/MEK and PI3K/Akt pathways
16953805 studies imply that distinct polymorphisms in human epithelial CEACAMs have the potential to decrease or increase the risk of infection by the receptor-targeting pathogens
16929097 the N-terminal domain of human CEACAM1 contains the binding target of the opacity proteins during invasion of Neisseria meningitidis and N. gonorrhoeae
16924126 CEACAM1 may be an interesting progression marker in squamous intraepithelial lesions and cervical cancer, in particular due to reported immunoregulatory properties.
16724098 This Review considers the evidence for CEACAM1 involvement in immunity, with emphasis on its functions as a regulatory co-receptor for both lymphoid and myeloid cell types.
16633066 study shows the expression pattern of osteopontin in cellular populations of normal endometrium and in endometrial carcinoma and its correlation with the expression of CEACAM1
16568082 data show that disappearance of epithelial CEACAM1 in PIN is accompanied by its upregulation in adjacent vasculature which apparently correlates with vascular destabilization and increased vascularization of prostate cancer
16332726 first report demonstrating that activators of PKC are able to specifically induce the expression of CEACAM1 in human carcinoma cells
16291724 The expression of CEACAM1-L led to an increased phosphorylation of focal adhesions and to altered cytoskeletal rearrangements during monolayer wound healing assays.
16282604 findings suggest that CEACAM1 participates in immune regulation in physiological conditions and in pathological conditions, such as inflammation, autoimmune disease, and cancer
16246332 Binding of DC-SIGN to both CEACAM1 and Mac-1 is required to establish cellular interactions with neutrophils.
16115956 Data show that variants of Neisseria gonorrhoeae that bind to human carcinoembryonic antigen-related cell adhesion molecules (CEACAMs) 1 and 6 failed to induce detachment and, instead, promoted enhanced host cell adhesion to the ECM.
15956076 OPN and CEACAM1 may act as a functional complex involved in the regulation of placental invasiveness.
15917161 Observational study of gene-disease association. (HuGE Navigator)
15905509 Heterophilic interactions of carcinoembryonic antigen and CEACAM1 inhibit killing by natural killer (NK) cells. The N-terminal domain of CEACAM1 is crucial but not sufficient for both CEACAM1-CEACAM1 homophilic and CEACAM1-CEA heterophilic interactions.
15687237 transmembrane CEACAM1-L expressed on endothelial cells is implicated in the activation phase of angiogenesis by affecting the cytoskeleton architecture and integrin-mediated signaling
15604255 CEACAM1 is up-regulated in endothelial cells of angiogenic blood vessels. This in turn is involved in the switch from noninvasive and nonvascularized to invasive and vascularized bladder cancer.
15602572 role in developing of hyperplastic polyps leading to colon cancer
15568039 failure of the maturing colon cell to express CEACAM1 is likely to contribute to the development of hyperplastic lesions
15536067 constitutive expression of CEACAM1 in microvascular endothelial cells switches them to an angiogenic phenotype, whereas CEACAM1 silencing apparently abrogates the VEGF-induced morphogenetic effects during capillary formation
15509546 CEACAM1 and alpha(v)beta(3) integrin are functionally interconnected with respect to the invasive growth of melanomas
15356119 The amino-terminal end of CEACAM1 interacts with CEACAM5, but not with CEACAM6. Both CEACAM1 and CEACAM5 contain the Arg and Gln residues in positions 43 and 44, respectively, whereas CEACAM6 contains 43-Ser and 44-Leu.
15317738 The sequential digestions clearly identified several different Lewis x glycan epitopes, which may modulate the cell adhesive functions of CEACAM1
15184366 the N-domain of CEACAM1 does not show evidence of recombination
15004155 CEACAM1-4L (long), but not the -4S (short)isoform inhibits IL-2 production in transfected Jurkat cells, while CEACAM1-4S, but not the -4L isoform inhibits proliferation in transfected Kit-225 cells.
15004154 The long and short cytoplasmic tails of CEACAM1 serve as inhibitory and costimulatory receptors, respectively, in T cell regulation.
14990688 cholesterol is an essential membrane fusion cofactor that can act with or without CEACAMs to promote murine hepatitis virus entry
14522961 CEACAM1, a cell-cell adhesion molecule, directly associates with annexin II
12571236 CEACAM1 has a role in internalizing bacteria to epithelial cells
12522268 CEACAM1-4S mediates apoptosis and reverts mammary carcinoma cells to a normal morphogenic phenotype in a 3D culture.
12370272 Role of CEACAM1 protein in the inhibition of activated decidual lymphocyte functions.
12122002 inhibition of prostate tumor angiogenesis by the tumor suppressor CEACAM1
12011132 High CEACAM 1 expression is associated with development of metastasis in primary cutaneous malignant melanoma patients
11994468 Only the long cytoplasmic domain isoform of CEACAM1 is expressed in human granulocytes, B cells, and T cells, since GPI-linked CEA-related proteins have functionally replaced the short cytoplasmic domains in the human.
11912215 Quaternary structure of coronavirus spikes in complex with carcinoembryonic antigen-related cell adhesion molecule cellular receptors
11884449 The expression of CD66a observed on NK cells from patients with malignant melanoma suggest the existence of a class I MHC-independent inhibitory mechanism of defense used by these cells to evade attack by CD66a-positive NK cells.
11751883 ability of N. gonorrhoeae to up-regulate its epithelial receptor CEACAM1 through NF-kappaB suggests an important mechanism allowing efficient bacterial colonization during the initial infection process.
10955775 The expression ratio of the long-form and the short-form generated from CEACAM1 (C-CAM1) mRNA by alternative splicing differs significantly in primary NSCLC tissues.

AA Sequence

MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKG      1 - 70
ERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHV     71 - 140
YPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDT    141 - 210
GPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQS    211 - 280
TQELFIPNITVNNSGSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCST    281 - 350
NDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALP    351 - 420
QENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDHSNDPPNKMNE    421 - 490
VTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ                                      491 - 526
//

Text Mined References (190)

PMID Year Title
27074014 2016 Serum CEACAM1 Level Is Associated with Diagnosis and Prognosis in Patients with Osteosarcoma.
26688824 2015 Serum CEACAM1 Elevation Correlates with Melanoma Progression and Failure to Respond to Adoptive Cell Transfer Immunotherapy.
26653024 2016 Carcinoembryonic antigen-related cell adhesion molecule 1 is expressed and as a function histotype in ovarian tumors.
26646010 2015 Kaposi's Sarcoma-Associated Herpesvirus Interleukin-6 Modulates Endothelial Cell Movement by Upregulating Cellular Genes Involved in Migration.
26343926 2015 Assay of serum CEACAM1 as a potential biomarker for breast cancer.
26341981 2015 Down-regulation of CEACAM1 in breast cancer.
26301891 2015 MITF is a critical regulator of the carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) in malignant melanoma.
26238781 2015 Ceacam1L Modulates STAT3 Signaling to Control the Proliferation of Glioblastoma-Initiating Cells.
26107193 2015 Comparative Study of Carcinoembryonic Antigen Tumor Marker in Stomach and Colon Cancer Patients in Khyber Pakhtunkhwa.
26081722 2015 Roles of CEACAM1 in cell communication and signaling of lung cancer and other diseases.
25987051 2015 Value of Combined Detection of Serum CEA, CA72-4, CA19-9 and TSGF in the Diagnosis of Gastric Cancer.
25987049 2015 Correlation between Serum Carcinoembryonic Antigen Level and Histologic Subtype in Resected Lung Adenocarcinoma.
25824372 2015 Inhibition of NKp30- and 2B4-mediated NK cell activation by evolutionary different human and bovine CEACAM1 receptors.
25744717 2015 CEACAM1-3S Drives Melanoma Cells into NK Cell-Mediated Cytolysis and Enhances Patient Survival.
25582745 2015 Positive postoperative CEA is a strong predictor of recurrence for patients after resection for colorectal liver metastases.
25575053 2015 [Silencing of carcinoembryonic antigen-related cell adhesion molecule 1 inhibits proliferation and induces apoptosis in human glioma SHG44 cells].
25551300 2015 Diagnostic performance of CD66c in lung adenocarcinoma-associated malignant pleural effusion: comparison with CEA, CA 19-9, and CYFRA 21-1.
25547406 2015 CEACAM1 and hollow spheroid formation modulate the chemosensitivity of colorectal cancer to 5-fluorouracil.
25409014 2014 Carcinoembryonic antigen-related cell adhesion molecules (CEACAM) 1, 5 and 6 as biomarkers in pancreatic cancer.
25368272 2014 Measurement of serum carcinoembryonic antigen, carbohydrate antigen 19-9, cytokeratin-19 fragment and matrix metalloproteinase-7 for detecting cholangiocarcinoma: a preliminary case-control study.
25363763 2015 CEACAM1 regulates TIM-3-mediated tolerance and exhaustion.
24931667 2014 CEACAM1 promotes melanoma cell growth through Sox-2.
24846314 2014 Expression of carcinoembryonic antigen-related cell adhesion molecule 1(CEACAM1) and its correlation with angiogenesis in gastric cancer.
24743304 2014 Soluble CEACAM8 interacts with CEACAM1 inhibiting TLR2-triggered immune responses.
24716460 2015 Abnormal expression of CD66a promotes proliferation and inhibits apoptosis of human leukemic B cells in vitro.
24650050 2014 IRF-1 regulates alternative mRNA splicing of carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) in breast epithelial cells generating an immunoreceptor tyrosine-based inhibition motif (ITIM) containing isoform.
24587171 2014 Neutrophils infiltration in the tongue squamous cell carcinoma and its correlation with CEACAM1 expression on tumor cells.
24518592 2014 Gene expression profiling reveals GC and CEACAM1 as new tools in the diagnosis of lung carcinoids.
24390710 2014 CEACAM1 long cytoplasmic domain isoform is associated with invasion and recurrence of hepatocellular carcinoma.
24302721 2014 Phosphorylation of CEACAM1 molecule by calmodulin kinase IID in a three-dimensional model of mammary gland lumen formation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24072270 2013 Elevated levels of serum tumor markers CA 15-3 and CEA are prognostic factors for diagnosis of metastatic breast cancers.
24005674 2013 Inside-out signaling promotes dynamic changes in the carcinoembryonic antigen-related cellular adhesion molecule 1 (CEACAM1) oligomeric state to control its cell adhesion properties.
23992005 2013 Clinical observations on the association between diagnosis of lung cancer and serum tumor markers in combination.
23991991 2013 CEA and CA 19-9 are still valuable markers for the prognosis of colorectal and gastric cancer patients.
23991977 2013 Serum CEA level change and its significance before and after Gefitinib therapy on patients with advanced non-small cell lung cancer.
23933369 2013 Expression of human CEACAM1 in transgenic mice limits the Opa-specific immune response against meningococcal outer membrane vesicles.
23894299 2013 Increased CD4(+) T cell co-inhibitory immune receptor CEACAM1 in neonatal sepsis and soluble-CEACAM1 in meningococcal sepsis: a role in sepsis-associated immune suppression?
23886200 2013 Expression and significance of TSGF, CEA and AFP in patients before and after radical surgery for colon cancer.
23885995 2013 Clinical and experimental studies regarding the expression and diagnostic value of carcinoembryonic antigen-related cell adhesion molecule 1 in non-small-cell lung cancer.
23780386 2013 Carcinoembryonic antigen-related cell adhesion molecule 1 inhibits MMP-9-mediated blood-brain-barrier breakdown in a mouse model for ischemic stroke.
23760586 2013 Elevation of preoperative s-CEA concentration in stage IIA colorectal cancer can also be a high risk factor for stage II patients.
23696226 2013 CEACAM1 on activated NK cells inhibits NKG2D-mediated cytolytic function and signaling.
23651919 2013 CEACAM1 expression in oligodendrocytes of the developing rat brain shows a spatiotemporal relation to myelination and is altered in a model of encephalopathy of prematurity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23499736 2013 CEACAM1 regulates Fas-mediated apoptosis in Jurkat T-cells via its interaction with ?-catenin.
23452434 2013 Carcinoembryonic antigen (CEA) level, CEA ratio, and treatment outcome of rectal cancer patients receiving pre-operative chemoradiation and surgery.
23358633 2013 Role of CEACAM1 and CEACAM20 in an in vitro model of prostate morphogenesis.
23349235 2013 Human endometrial stromal cell-trophoblast interactions: mutual stimulation of chemotactic migration and promigratory roles of cell surface molecules CD82 and CEACAM1.
23319418 2013 Carcinoembryonic antigen-related cell adhesion molecule 1 negatively regulates granulocyte colony-stimulating factor production by breast tumor-associated macrophages that mediate tumor angiogenesis.
23243275 2013 Retinoid agonist Am80-enhanced neutrophil bactericidal activity arising from granulopoiesis in vitro and in a neutropenic mouse model.
23219815 2013 CEACAM1 inhibits cell-matrix adhesion and promotes cell migration through regulating the expression of N-cadherin.
23038226 2012 Loss of expression of the tumor suppressor CEACAM1 links different hereditary colorectal carcinoma subtypes to the genesis of sporadic colorectal carcinoma.
23010737 2013 Elevated CEA levels and low distance of the tumor from the anal verge are predictors of incomplete response to chemoradiation in patients with rectal cancer.
22932077 2012 Loss of membranous carcinoembryonic antigen-related cell adhesion molecule 1 expression is related to decreased relapse-free survival of hepatocellular carcinoma following liver transplantation.
22922158 2012 [Role of CEACAM in neutrophil activation].
22751559 2012 The expression and modulation of CEACAM1 and tumor cell transformation.
22482415 2012 [Expression and significance of CEACAM1 and HBx in HBV related hepatocellular carcinoma].
22209504 2012 The evaluation of SOX9 expression and its relationship with carcinoembryonic antigen-related cell adhesion molecule 1 in gastric neoplastic and nonneoplastic lesions.
22162753 2011 Investigations on the usefulness of CEACAMs as potential imaging targets for molecular imaging purposes.
22143889 2011 CEACAM1 dampens antitumor immunity by down-regulating NKG2D ligand expression on tumor cells.
22135912 2011 Clinicopathological significance of CEACAM1 gene expression in breast cancer.
22088515 2011 Utility of squamous cell carcinoma antigen, carcinoembryonic antigen, Cyfra 21-1 and neuron specific enolase in lung cancer diagnosis: a prospective study from China.
22064717 2012 Defining the roles of human carcinoembryonic antigen-related cellular adhesion molecules during neutrophil responses to Neisseria gonorrhoeae.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21695697 2011 The relationships between perioperative CEA, CA 19-9, and CA 72-4 and recurrence in gastric cancer patients after curative radical gastrectomy.
21671129 2011 The possible roles of OPN-regulated CEACAM1 expression in promoting the survival of activated T cells and the apoptosis of oral keratinocytes in oral lichen planus patients.
21569294 2011 The CEACAM1 expression is decreased in the liver of severely obese patients with or without diabetes.
21487066 2011 Plasma markers for identifying patients with metastatic melanoma.
21413011 2011 Re-expression of CEACAM1 long cytoplasmic domain isoform is associated with invasion and migration of colorectal cancer.
21398516 2011 Mechanistic control of carcinoembryonic antigen-related cell adhesion molecule-1 (CEACAM1) splice isoforms by the heterogeneous nuclear ribonuclear proteins hnRNP L, hnRNP A1, and hnRNP M.
21298042 2011 Neisseria meningitidis has two independent modes of recognizing its human receptor CEACAM1.
21269460 2011 Initial characterization of the human central proteome.
21106423 2011 Inhibitor of differentiation is overexpressed with progression of benign to malignant lesions and related with carcinoembryonic antigen-related cell adhesion molecule 1 distribution in mammary glands.
21050451 2010 Regulation of CEACAM1 transcription in human breast epithelial cells.
20737948 2010 [The expression of CEACAM-1 and CXCL-14 in infantile hemangioma].
20682994 2010 Epithelial versus endothelial CEACAM1 expression and angiogenesis in epididymal adenomatoid tumor.
20524097 2011 Genetic alterations and expression pattern of CEACAM1 in colorectal adenomas and cancers.
20406467 2010 CEACAM1 recognition by bacterial pathogens is species-specific.
20305326 2010 ACE gene insertion/deletion polymorphism among patients with type 2 diabetes, and its relationship with metabolic syndrome at Sardjito Hospital Yogyakarta, Indonesia.
20090913 2010 Deregulation of the CEACAM expression pattern causes undifferentiated cell growth in human lung adenocarcinoma cells.
20034698 2010 DC-SIGN and SRCL bind glycans of carcinoembryonic antigen (CEA) and CEA-related cell adhesion molecule 1 (CEACAM1): recombinant human glycan-binding receptors as analytical tools.
19948502 2009 The CEACAM1 N-terminal Ig domain mediates cis- and trans-binding and is essential for allosteric rearrangements of CEACAM1 microclusters.
19720754 2009 Opa+ and Opa- isolates of Neisseria meningitidis and Neisseria gonorrhoeae induce sustained proliferative responses in human CD4+ T cells.
19633846 2010 Systemic dysregulation of CEACAM1 in melanoma patients.
19545674 2009 Expression of carcinoembryonic antigen-related cell adhesion molecule 1 in acute rejection of human renal allografts.
19487071 2010 CEACAM1: a novel urinary marker for bladder cancer detection.
19461083 2009 Protein expression of carcinoembryonic antigen cell adhesion molecules in benign and malignant melanocytic skin lesions.
19454653 2009 Pivotal advance: CEACAM1 is a negative coreceptor for the B cell receptor and promotes CD19-mediated adhesion of B cells in a PI3K-dependent manner.
19442569 2009 CEACAM1 distribution and it's effects on angiogenesis and lymphangiogenesis in oral carcinoma.
19407471 2009 Downregulation of carcinoembryonic antigen-related cell adhesion molecule 1 in oral squamous cell carcinoma: correlation with tumor progression and poor prognosis.
19361387 2009 [CEACAM1 as a central modulator of metabolism, tumor progression, angiogenesis and immunity].
19349857 2009 CEACAM1 expression in pancreatic endocrine tumors.
19243897 2009 The different expression of carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM1) and possible roles in gastric carcinomas.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19146852 2009 Mutational analysis of the cytoplasmic domain of CEACAM1-4L in humanized mammary glands reveals key residues involved in lumen formation: stimulation by Thr-457 and inhibition by Ser-461.
19077207 2008 Interdependency of CEACAM-1, -3, -6, and -8 induced human neutrophil adhesion to endothelial cells.
19020551 2009 AP-1-controlled hepatocyte growth factor activation promotes keratinocyte migration via CEACAM1 and urokinase plasminogen activator/urokinase plasminogen receptor.
18843289 2009 Cytokine-induced CEACAM1 expression on keratinocytes is characteristic for psoriatic skin and contributes to a prolonged lifespan of neutrophils.
18836450 2008 CEACAM1 inhibits Toll-like receptor 2-triggered antibacterial responses of human pulmonary epithelial cells.
18794798 2008 CEACAM1, a SOX9 direct transcriptional target identified in the colon epithelium.
18705345 Detection of circulating gastric cancer cells in peripheral blood using real time quantitative RT-PCR.
18507857 2008 Altered splicing of CEACAM1 in breast cancer: identification of regulatory sequences that control splicing of CEACAM1 into long or short cytoplasmic domain isoforms.
18497748 2008 The Moraxella adhesin UspA1 binds to its human CEACAM1 receptor by a deformable trimeric coiled-coil.
18453603 2008 CEACAM1 dynamics during neisseria gonorrhoeae suppression of CD4+ T lymphocyte activation.
18445773 2008 Direct interaction of tumor suppressor CEACAM1 with beta catenin: identification of key residues in the long cytoplasmic domain.
18424730 2008 Carcinoembryonic antigen-related cell adhesion molecule 1 inhibits proximal TCR signaling by targeting ZAP-70.
18278069 2008 The CEACAM1-mediated apoptosis pathway is activated by CEA and triggers dual cleavage of CEACAM1.
18215438 2008 Elevated expression of carcinoembryonic antigen-related cell adhesion molecule 1 (CEACAM-1) is associated with increased angiogenic potential in non-small-cell lung cancer.
18081725 2008 The CEACAM1 transmembrane domain, but not the cytoplasmic domain, directs internalization of human pathogens via membrane microdomains.
17979980 2008 hCEACAM1-4L downregulates hDAF-associated signalling after being recognized by the Dr adhesin of diffusely adhering Escherichia coli.
17960155 2008 Haplotypic diversity in human CEACAM genes: effects on susceptibility to meningococcal disease.
17764466 2007 IFN-gamma amplifies NFkappaB-dependent Neisseria meningitidis invasion of epithelial cells via specific upregulation of CEA-related cell adhesion molecule 1.
17761831 2007 Lymphatic reprogramming of microvascular endothelial cells by CEA-related cell adhesion molecule-1 via interaction with VEGFR-3 and Prox1.
17623671 2007 The cell adhesion receptor carcinoembryonic antigen-related cell adhesion molecule 1 regulates nucleocytoplasmic trafficking of DNA polymerase delta-interacting protein 38.
17620353 2007 Neisserial outer membrane vesicles bind the coinhibitory receptor carcinoembryonic antigen-related cellular adhesion molecule 1 and suppress CD4+ T lymphocyte function.
17612570 2007 Tumor suppressor carcinoembryonic antigen-related cell adhesion molecule 1 potentates the anchorage-independent growth of human hepatoma HepG2 cells.
17605118 2007 [One molecule, two faces. Epithelial loss of cell adhesion molecule CEACAM1 activates angiogenesis in bladder and prostate cancer].
17546042 2007 Role of CEACAM1 isoforms in an in vivo model of mammary morphogenesis: mutational analysis of the cytoplasmic domain of CEACAM1-4S reveals key residues involved in lumen formation.
17471435 2007 The UspA1 protein of Moraxella catarrhalis induces CEACAM-1-dependent apoptosis in alveolar epithelial cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17192268 2007 Mutation analysis of the short cytoplasmic domain of the cell-cell adhesion molecule CEACAM1 identifies residues that orchestrate actin binding and lumen formation.
17167768 2007 GPI-anchored CEA family glycoproteins CEA and CEACAM6 mediate their biological effects through enhanced integrin alpha5beta1-fibronectin interaction.
17143599 2007 The expression of CD66a and possible roles in colorectal adenoma and adenocarcinoma.
17071610 2006 CEACAM1 (CD66a) promotes human monocyte survival via a phosphatidylinositol 3-kinase- and AKT-dependent pathway.
16953805 2007 Mutational analysis of human CEACAM1: the potential of receptor polymorphism in increasing host susceptibility to bacterial infection.
16929097 2006 Structure of the N-terminal domain of human CEACAM1: binding target of the opacity proteins during invasion of Neisseria meningitidis and N. gonorrhoeae.
16924126 2006 CEACAM1 in cervical cancer and precursor lesions: association with human papillomavirus infection.
16724098 2006 CEACAM1: contact-dependent control of immunity.
16633066 2006 Expression pattern of osteopontin in endometrial carcinoma: correlation with expression of the adhesion molecule CEACAM1.
16568082 2006 CEA-related cell adhesion molecule-1 is involved in angiogenic switch in prostate cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16332726 2006 Stimulation of CEACAM1 expression by 12-O-tetradecanoylphorbol-13-acetate (TPA) and calcium ionophore A23187 in endometrial carcinoma cells.
16291724 2005 CEACAM1 functionally interacts with filamin A and exerts a dual role in the regulation of cell migration.
16282604 2006 CEACAM1, an adhesion molecule of human granulocytes, is fucosylated by fucosyltransferase IX and interacts with DC-SIGN of dendritic cells via Lewis x residues.
16246332 2005 Interactions of DC-SIGN with Mac-1 and CEACAM1 regulate contact between dendritic cells and neutrophils.
16115956 2005 CEACAM engagement by human pathogens enhances cell adhesion and counteracts bacteria-induced detachment of epithelial cells.
15956076 2005 Osteopontin is colocalized with the adhesion molecule CEACAM1 in the extravillous trophoblast of the human placenta and enhances invasion of CEACAM1-expressing placental cells.
15952183 2005 Loss of carcinoembryonic antigen-related cell adhesion molecule 1 expression is an adverse prognostic factor in hepatocellular carcinoma.
15917161 2005 Bone mineral density and five prominent candidate genes in Chinese men: associations, interaction effects and their implications.
15905509 2005 Carcinoembryonic antigen (CEA) inhibits NK killing via interaction with CEA-related cell adhesion molecule 1.
15687237 2005 Transmembrane CEACAM1 affects integrin-dependent signaling and regulates extracellular matrix protein-specific morphology and migration of endothelial cells.
15604255 2004 Dual role of carcinoembryonic antigen-related cell adhesion molecule 1 in angiogenesis and invasion of human urinary bladder cancer.
15602572 2004 CEACAM1 and hyperplastic polyps: new links in the chain of events leading to colon cancer.
15568039 2004 The human tumor suppressor CEACAM1 modulates apoptosis and is implicated in early colorectal tumorigenesis.
15536067 2005 Pro-angiogenic signaling by the endothelial presence of CEACAM1.
15509546 2004 CEACAM1 enhances invasion and migration of melanocytic and melanoma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467833 2004 CEACAM1 modulates epidermal growth factor receptor--mediated cell proliferation.
15356119 2004 The critical role of residues 43R and 44Q of carcinoembryonic antigen cell adhesion molecules-1 in the protection from killing by human NK cells.
15317738 2005 Identification of Lewis x structures of the cell adhesion molecule CEACAM1 from human granulocytes.
15184366 2004 Two variable regions in carcinoembryonic antigen-related cell adhesion molecule1 N-terminal domains located in or next to monoclonal antibody and adhesion epitopes show evidence of recombination in rat but not in human.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15004155 2004 The cell-cell adhesion molecule carcinoembryonic antigen-related cellular adhesion molecule 1 inhibits IL-2 production and proliferation in human T cells by association with Src homology protein-1 and down-regulates IL-2 receptor.
15004154 2004 Carcinoembryonic antigen-related cellular adhesion molecule 1 isoforms alternatively inhibit and costimulate human T cell function.
14990688 2004 Requirements for CEACAMs and cholesterol during murine coronavirus cell entry.
14522961 2003 CEACAM1, a cell-cell adhesion molecule, directly associates with annexin II in a three-dimensional model of mammary morphogenesis.
12571236 2003 Phosphatidylinositol 3-kinases in carcinoembryonic antigen-related cellular adhesion molecule-mediated internalization of Neisseria gonorrhoeae.
12522268 2003 CEACAM1-4S, a cell-cell adhesion molecule, mediates apoptosis and reverts mammary carcinoma cells to a normal morphogenic phenotype in a 3D culture.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370272 2002 Pivotal role of CEACAM1 protein in the inhibition of activated decidual lymphocyte functions.
12122002 2002 Inhibition of prostate tumor angiogenesis by the tumor suppressor CEACAM1.
12108545 2002 Clustering-induced signaling of CEACAM1 in PC12 cells.
11994468 2002 Carcinoembryonic antigen-related cell adhesion molecule 1 expression and signaling in human, mouse, and rat leukocytes: evidence for replacement of the short cytoplasmic domain isoform by glycosylphosphatidylinositol-linked proteins in human leukocytes.
11850628 2002 Neisserial binding to CEACAM1 arrests the activation and proliferation of CD4+ T lymphocytes.
11501563 1999 Redefined nomenclature for members of the carcinoembryonic antigen family.
11293162 2001 Expression pattern of the adhesion molecule CEACAM1 (C-CAM, CD66a, BGP) in gestational trophoblastic lesions.
11035932 2000 Cell adhesion molecule CEACAM1 associates with paxillin in granulocytes and epithelial and endothelial cells.
10955775 2000 C-CAM1, a candidate tumor suppressor gene, is abnormally expressed in primary lung cancers.
10882072 2000 CEA-related cell adhesion molecule 1: a potent angiogenic factor and a major effector of vascular endothelial growth factor.
10805733 2000 The differential effects of pp120 (Ceacam 1) on the mitogenic action of insulin and insulin-like growth factor 1 are regulated by the nonconserved tyrosine 1316 in the insulin receptor.
10553088 1999 Identification of CD66a and CD66b as the major galectin-3 receptor candidates in human neutrophils.
9867848 1999 The carboxyl-terminal region of biliary glycoprotein controls its tyrosine phosphorylation and association with protein-tyrosine phosphatases SHP-1 and SHP-2 in epithelial cells.
8543346 1995 Immunochemical analysis of carcinoembryonic antigen (CEA)-related antigens differentially localized in intracellular granules of human neutrophils.
8423792 1993 Human biliary glycoprotein gene: characterization of a family of novel alternatively spliced RNAs and their expressed proteins.
8055923 1994 Transcriptional control of the human biliary glycoprotein gene, a CEA gene family member down-regulated in colorectal carcinomas.
8018919 1994 CD66 identifies the biliary glycoprotein (BGP) adhesion molecule: cloning, expression, and adhesion functions of the BGPc splice variant.
7628460 1995 Characterization and transcriptional activity of the mouse biliary glycoprotein 1 gene, a carcinoembryonic antigen-related gene.
7626603 1995 Insulin-stimulated phosphorylation of recombinant pp120/HA4, an endogenous substrate of the insulin receptor tyrosine kinase.
7606710 1995 Cell- and region-specific expression of biliary glycoprotein and its messenger RNA in normal human colonic mucosa.
7592607 1995 Receptor-mediated internalization of insulin. Potential role of pp120/HA4, a substrate of the insulin receptor kinase.
7504281 1993 Biliary glycoprotein, a potential human cell adhesion molecule, is down-regulated in colorectal carcinomas.
7478590 1995 Association of pp60c-src with biliary glycoprotein (CD66a), an adhesion molecule of the carcinoembryonic antigen family downregulated in colorectal carcinomas.
2537311 1989 Carcinoembryonic antigens: alternative splicing accounts for the multiple mRNAs that code for novel members of the carcinoembryonic antigen family.
2457922 1988 Molecular cloning of a cDNA coding biliary glycoprotein I: primary structure of a glycoprotein immunologically crossreactive with carcinoembryonic antigen.
2025273 1991 Three novel molecular forms of biliary glycoprotein deduced from cDNA clones from a human leukocyte library.
1572649 1992 Long-range chromosomal mapping of the carcinoembryonic antigen (CEA) gene family cluster.
385181 1979 Immunofluorescence studies on the occurrence and localization of the CEA-related biliary glycoprotein I (BGP I) in normal human gastrointestinal tissues.