Property Summary

NCBI Gene PubMed Count 19
PubMed Score 29.36
PubTator Score 17.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5

Gene RIF (5)

AA Sequence

MYGSCLLEKEAGMYPGTLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMPSMDPHWPSLG      1 - 70
VWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTD     71 - 140
AGAAKASSPSRSRHSPYAWMRKTVQVTGKTRTKEKYRVVYTDHQRLELEKEFHCNRYITIQRKSELAVNL    141 - 210
GLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQV    211 - 280
IVSE                                                                      281 - 284
//

Text Mined References (20)

PMID Year Title