Property Summary

NCBI Gene PubMed Count 256
PubMed Score 784.90
PubTator Score 618.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ulcerative colitis -1.500 8.9e-05
psoriasis 2.500 6.5e-09

Gene RIF (241)

PMID Text
26926447 Immunohistochemical panel of CDX2, p120ctn, c-Myc, and Jagged1 proteins would be to distinguish between low/high grade dysplasia in histologically challenging cases of Barrett's esophagus.
26902420 Results point out the complex interplay between the DSB DNA repair activity and the homeoproteins HoxB7 and Cdx2 in colon cancer cells.
26841784 Changes in CDX1/CDX2 mRNA expression in gastric mucosa following H. pylori eradication showed only insignificant results
26789870 Lack of CDX2 expression identified a subgroup of patients with high-risk stage II colon cancer who appeared to benefit from adjuvant chemotherapy.
26772394 We conclude that CDX2 is a sensitive and relatively specific marker for yolk sac tumor among the nonteratomatous germ cell testicular tumors
26759244 findings illuminated a role for NOD1 signaling in attenuating H. pylori-induced Cdx2 expression in gastric epithelial cells
26743476 Suggest that NKX6.3 might function as a master regulator of gastric differentiation by affecting SOX2 and CDX2 expression and the NKX6.3 inactivation may result in intestinal metaplasia in gastric epithelial cells.
26551082 that CDX2 downregulation is associated with mismatch repair deficiency, right-sided tumors, and poor differentiation at both the mRNA and protein level
26469326 CK7, TTF-1 and napsin A are predominantly expressed in primary lung adenocarcinoma patients, with CDX-2 being inconsistently expressed.
26346470 Daily intake of vitamin D-FD for 12 weeks improved the central obesity indices in T2D subjects, and the improvement was more pronounced in the carriers of the AA genotype of VDR-Cdx-2.
26238762 Nuclear transcription factor CDX2 inhibits gastric cancercell growth and reverses epithelialtomesenchymal transition in vitro and in vivo.
26229399 In active ulcerative colitis HGFR/CDX2 participate in mucosal regeneration by undergoing mesenchymal-to-epithelial transition.
26030973 The loss of CDX2 expression in the nuclei of metaplastic epithelium may serve as a predictor of neoplastic transformation of gastric mucosa.
26005051 CDX2 expression inhibits the growth of colorectal tumor cells, possibly by downregulating the gene expression.
25989273 A pancreaticobiliary histomolecular classification (PB) was defined as a sample with pancreaticobiliary histology, positive MUC1 and negative CDX2 expression
25867765 CDX2 transcriptionally regulates ST6GalNAc-I gene expression, specifically in the preneoplastic intestinal metaplasia lesion.
25849303 Results show an association between Cdx2 polymorphism and an aggressive phenotype of breast neoplasm.
25799416 A non-significant association was observed between VDR cdx2 polymorphism and breast cancer, however the GG genotype was at risk of developing breast cancer.
25759548 CDX2 has a better positive predictive value than alcian blue in detecting esophageal intestinal metaplasia.
25738688 CDX2 single-nucleotide polymorphism is associated with cancer risk.
25738600 Overexpression of CDX2 inhibits the growth of the human gastric cancer cells in vivo and in vitro.
25663765 Loss of CDX2 expression is associated with aggressive clinical behavior and can be used as a prognostic marker in colorectal cancer.
25300947 SOX2 combined with CDX2 expression profile in gastric cancer segregate patients into different prognostic groups.
25196071 CDX2 is acquired de novo in Iintestinal metaplasia and maintained in dysplasia
25171776 concluded that CDX2 is likely regulated by the PI3K/Akt signaling pathway during trophoblast cell invasion
25138215 Intestinal nuclear bile acid farnesoid X receptor is regulated transcriptionally by CDX2.
25131200 The intestine-specific transcription factor CDX2 and Wnt effector TCF7L2 bind near rs16969681, with significantly higher affinity for the colorectal cancer risk allele.
25081540 Immunostaining of CDX2 and CK20 provides beneficial information if considering whether to perform an endoscopic papillectomy (EP).
25042702 Although NANOG was required for cardiac specification but blocked somitic subtypes, CDX2 was required for somitic mesoderm but blocked cardiac differentiation.
24974686 CDX2 appears to induce the transformation of the normal oesophageal mucosa to cardia type, which then differentiates to an intestinal type under the influence of gastro-oesophageal reflux disease.
24953186 SHP-2/ERK/MAPK pathway regulates the expression of CDX2 in basal conditions
24908142 BRAF-mutated microsatellite stable colorectal carcinoma often displays reduced CDX2 and increased CK7 expression
24841154 With follow up, we could not confirm that CDX2 expression had a prognostic significance.
24814920 Findings indicate that the CDX-2 expression is decreased in ulcerative colitis. CDX2 is involved in the crosstalk between TNF-alpha and the Wnt signalling pathway, which might be of importance in the link between intestinal inflammation and tumourigenesis.
24794431 pSMAD/CDX2 interaction is essential for the switch toward an intestinal phenotype in Barrett's esophagus.
24744585 CDX2 appears to forward control regenerating IV and the multidrug resistance 1 expression signaling pathway for regulation of cell drug resistance [review]
24603585 CDX2, MUC1, MUC5AC, and MUC6 expression patterns may provide better estimations of survival after surgical resection of small intestinal adenocarcinoma.
24501326 TNF-alpha induces the expression of Wnt signaling components through a downregulation of the CDX2 expression that might have a tumor-promoting effect on colon cancer cells.
24489794 Only one third of pancreatic ductal adenocarcinoma patients retain some degree of CDX2 expression during progression from chronic pancreatitis, and this group has reduced median survival time.
24287273 Helicobacter pylori-induced tumorigenesis and invasiveness of gastric carcinoma cells is mediated by bacterial CagA via Cdx2-dependent targeting of Claudin-2.
24266897 Discriminated small-cell lung carcinoma from large-cell neuroendocrine lung carcinoma with immunohistochemical markers BAI3, CDX2 and VIL1.
24166180 Results sugggest that Cdx2 may play a role in the serrated pathway to colorectal cancer with BRAF(V600E), CpG Island Methylator Phenotype (CIMP)-high and mismatch repair (MMR)-deficiency.
24103759 CDX2, a known positive regulator of hepatocyte differentiation, was regulated by miR-181d and directly activated SOAT2 gene expression.
24025523 The CDX2/CK20 phenotype defines a distinct subgroup of colorectal cancers with microsatellite instability and poor differentiation
23958315 Data suggest that CDX2 plays a key part in differentiation of enterocytes (here, Caco-2 cells); CDX2 has dual roles as inhibitor of Wnt signaling at early stage and direct trans-activator of intestinal genes at late stage.
23918153 Certain SNPs of Cdx1 and Cdx2 and their interactions with other risk factors are associated with Barrett's esophagus (BE) and may contribute to human susceptibility to BE.
23887079 CDX2 was significantly increased in neuroendocrine tumors of ileum, while the overexpression of Oct4 was not statistically significant in these tumors.
23864778 CDX2 may be involved in regulating multiple signaling pathways in reversing multidrug resistance in gastric cancer cells.
23846317 CDX-2 is highly sensitive for the diagnosis of sinonasal Intestinal-type adenocarcinoma
23834763 CDX2 may be used routinely with morphology in subtyping of periampullary carcinoma, and a panel of markers may be used in morphologically difficult cases.
23828549 High CDX2 expression is associated with intestinal neoplasms.
23734674 CDX2 expression was strictly associated with the columnar cell variant of papillary thyroid carcinoma.
23649760 This meta-analysis suggested that the Cdx-2 polymorphism of VDR gene would be a risk factor for cancer.
23613102 The differential regulation of the gene expression of CDX1, CDX2 and SOX2 in patients with gastric cancer affects not only the tumour but also the non-neoplastic tumour-distant mucosa.
23574843 Reduced CDX2 expression is associated with poor overall survical in patients with colorectal cancer and may be clinically useful as a marker for poor prognosis.
23568430 data indicate that a fine balance between SOX2 and CDX2 expression in the gastrointestinal tract is essential for proper development
23546539 The coexpression levels of PTEN and Cdx2 in GC tumors correlated with prognosis in GC patients. Cdx2 may play a role in the upregulation of PTEN by triggering PI3K/Akt inactivation in GC cells.
23545100 CDX2 protein may have critical role regulating intestinal metaplasia in cystitis glandularis. intestinal metaplasia
23488912 Data suggest that only one of 10 cases of a columnar cell variant of papillary thyroid carcinoma show positivity for CDX2 in tumor tissue or cell nuclei in tumor tissue. [CASE REPORT]
23439753 Data indicate that histologic subtype and CDX2 and MUC1 expression were significant prognostic variables.
23393221 CDX2 activated APC and AXIN2 promoter activities via intestinal cell-specific enhancer elements; results suggest that a low CDX2 level has influence on the Wnt signaling in invasive colon cancer cells possibly promoting cellular migration
23384906 Higher expression level of CDX2 gene was seen mostly in acute myeloid leukemia patients with FLT3-ITD mutation and with lower complete remission rates.
23382633 Case Report: report cdx2 expression/promoter methylation during progression of Barrett's esophagus to adenocarcinoma.
23317240 No association between the CDX2 G543C polymorphism was found in gastric atrophy and cancer.
23313847 these results provide the evidence that transcription factors CDX2 and EOMES may play critical roles in human induced trophoblast progenitor cell generation.
23202735 CDX2-driven leukemogenesis involves KLF4 repression and deregulated PPARgamma signaling.
23181722 Cdx2 is a prognostic factor in gastric cancer, which acts as a marker of good outcome in patients with gastric cancer
23133598 CDX2 protein directly regulates Reg IV expression in gastric cancer
23127929 The homeotic transcription factor CDX2 is expressed in the intestinal epithelium at all stages of development. It is lost or mutated in many gastrointestinal cancers. Review.
23112155 CDX2 is a tumor suppressor in colorectal cancer
23105122 CDX2 might be valuable in terms of narrowing the possible sites of origin to be considered in the setting of squamous cell carcinoma with unknown primary presenting with inguinal lymph node metastasis.
23026509 Age increased osteoporosis risk; whereas body mass index (BMI), number of reproductive years, 25OHD level and the Cdx-2 polymorphism in the VDR gene (when allele A is present) were found to be protective.
23011828 CDX2, COX2 and MUC2 expressions were seen in the intestinal epithelium having goblet cells in Barrett's esophagus
22895825 High CDX2 expression is associated with malignant germ cell tumors of the testes.
22895272 Pouch/peripouch and UC-associated adenocarcinoma had a comparable positive rate for CK7, CK20, and CDX2 by immunohistochemistry.
22892849 CDX2 is frequently methylated in lung cancer, and expression of CDX2 is regulated by promoter region hypermethylation. CDX2 may serve as a tumor suppressor in lung cancer and inhibits lung cancer cell proliferation by suppressing Wnt signaling.
22829163 CDX2 is a sensitive marker for assessing intestinal phenotypic expression in undifferentiated-type adenocarcinoma of the stomach.
22824143 EphA2 activation by ephrin-A1 induces tumor suppressor gene cdx-2 expression which attenuates cell proliferation, tumor growth and thus may be a promising therapeutic target against NSCLC.
22810971 Down-regulation of CDX2 is associated with epithelial ovarian cancer progression.
22791809 infected mice present BMP pathway upregulation, focal Cdx2 expression and decreased Sox2.
22783055 Cdx2 is useful for predicting the prognosis of gastric carcinoma.
22719836 conclude that homeodomain transcription factors Cdx1, Cdx2 and GATA4 regulate claudin-1 gene expression in human colon cancer cells
22671145 Data suggest that CDX2 is critical for maintenance of high levels of CFTR (cystic fibrosis transmembrane conductance regulator) expression in enterocytes; data also suggest that CFTR expression is controlled by multiple cis-regulatory factors.
22580340 CDX2 binds to the human GST P1 promoter via complex formation with Sp1 and controls the constitutive expression of GST P1 during Caco-2 cell differentiation.
22563170 Cdx2 was involved in regulating pro-gression of human gastric cancer cells MGC-803.
22547830 Transcription factors c-Myc and CDX2 mediate E-selectin ligand expression in colon cancer cells undergoing EGF/bFGF-induced epithelial-mesenchymal transition.
22523209 Authors conclude that CDX2 is selectively expressed in the columnar cell variant of papillary thyroid carcinoma (CCV-PTC)and can be used in distinguishing it from other variants of PTC with overlapping morphologic features.
22502678 High expression of CDX2 and villin may be involved in early-stage intestinal metaplasia and tumorigenesis in gastric cardia.
22495359 Three (17%) of 18 metastatic GICTs showed moderate IMP3 staining in 50% to 90% of the tumor cells, whereas CDX2 was expressed in 17 (94%) cases with moderate-to-strong staining in 50% to 100% of tumor cells
22449796 Enhanced expression of Cdx2 by stimulation with bile acids may induce intestinal differentiation of esophageal columnar cells by interaction with the Notch signaling pathway.
22438068 High expression of desmocollin 1 (DSC1) was observed in 41.6%, DSC2 in 58.0%, DSC3 in 61.4%, E-cadherin in 71.4%, CDX2 in 58.0%, PITX1 in 55.0%, CDK4 in 0.2%, TLE1 in 1.3%, Factor H in 42.5%, and MDM2 in 0.2% of colorectal carcinomas.
22407102 High CDX2 expression is associated with gastric carcinogenesis.
22364879 we found a strong correlation between Myc protein downregulation and the expression of the transcription factor Cdx2, suggesting the existence of a regulative link between these two proteins
22326557 The present results indicate that a TNF-alpha-mediated down-regulation of CDX2 can be related to suppressed expression of MEP1A during intestinal inflammation.
22268990 Both the CK7-/CK20+ phenotype and expression of the antibody CDX2 are highly specific and sensitive markers of colorectal origin.
22261707 Report Divergent expression of MUC5AC, MUC6, MUC2, CD10, and CDX-2 in dysplasia and intramucosal adenocarcinomas with intestinal and foveolar morphology and roles in neoplastic progression.
22202456 The transcription factor Cdx2 activates expression of the protocadherin Mucdhl, which interacts with beta-catenin and regulates activities of colon cancer cells.
22078291 Alpha-methylacyl-coenzyme A racemase expression is associated with mucin phenotypes of gastric neoplasia, particularly with the expression of CDX2 and MUC5AC.
22076569 BMP4 activation in non-specialized columnar metaplasia and early expression of CDX2 are involved in the columnar epithelial differentiation of Barrett's esophagus.
22016432 The human ASBT promoter was activated transcriptionally by CDX1 and CDX2.
21909647 a significant relation of PDX1 and CDX2 expressions among phenotypic classification of gastric carcinomas reveals an idea about similar functions for PDX1 and CDX2 in the evolution of gastric carcinoma.
21903586 miR-125b, a target of CDX2, regulates cell differentiation through repression of the core binding factor in hematopoietic malignancies
21816365 BRA was necessary for and preceded CDX2 expression.
21739268 CDX2 was mainly found in the gastrin-positive pancreatic neuroendocrine tumors (P-NETs)(5/8) and rarely in the D-NETs (1/10).
21572312 This study showed that CDX2 is expressed by urachal remnants of glandular type, noninvasive urachal mucinous cystic tumors and urachal adenocarcinomas.
21532856 CDX1 and CDX2 in cancer group was significantly higher than control group
21518475 Expression of CDX2 may be correlated with the pathogenesis and relapse of adult ALL.
21364588 Clinical significance of CDX2-positive circulating tumour cells in colorectal cancer patients.
21362237 The cdx2 positive expression is not related to the complete remission rate in acute leukemia patients.
21284881 Data show that CD26 mRNA and protein levels increase in a confluence-dependent manner in colon carcinoma cell lines, with c-Myc acting as a repressor and Cdx2 acting as an enhancer of CD26 expression.
21225631 Downregulation of CDX2 expression is associated with gastric cancer.
21224344 Results show that low levels of CDX2 accelerate colon tumorigenesis by reducing p27Kip1 levels.
21221877 Low CDX2 expression is associated with gallbladder adenocarcinoma.
21221798 Cdx2 protein expression and the prevalence of histologically detected intestinal metaplasia were higher in cases of endoscopically diagnosed open-type atrophic gastritis and metaplastic gastritis than in closed-type atrophic gastritis.
21074721 Results characterized enhancer elements specifically modified in differentiating intestinal epithelial cells and found enrichment of transcription factor-binding motifs corresponding to CDX2, a critical regulator of the intestine.
20699370 Data indicate that CDX2 directly regulates MDR1 gene expression through binding to elements in the promoter region.
20696899 Genome-wide analysis of DNA cis-regulatory regions bound by the intestine-restricted factor CDX2 in colonic cells uncovered highly significant overrepresentation of sequences that bind TCF4, a transcriptional effector of intestinal Wnt signaling.
20671195 Cdx2 regulates E-cadherin function indirectly by disrupting receptor tyrosine kinase activity and enhancing E-cadherin trafficking to the cell membrane compartment.
20658368 IL-1beta can stimulate CDX2 mRNA and protein expression in gastric epithelial cells.
20619754 These results confirm previously reported results suggesting that aberrant CDX2 and Sonic hedgehog (SHH) are highly expressed in Barrett's epithelium and may play a crucial role in the development of Barrett's epithelium.
20602288 There is no evidence for that CDX2 might play a role in tumourigenesis, invasive growth or tumour recurrence of pituitary adenomas or in tumourigenesis of craniopharyngiomas
20551175 the homeobox transcription factor Cdx2 controls apical-basolateral polarity in mouse enterocytes and human colonic epithelial cells
20518411 TTF-1 and CDX-2 are specific markers to separate metastatic pulmonary and GI ACs, respectively, from other metastatic ACs in serous effusions.
20514449 Hypoxia-inducible factor-1alpha induces down-regulation of CDX2 in colon carcinoma cells and Snail may be involved in this regulation process.
20444732 CDX2 and LI-cadherin are sensitive markers of intestinal metaplasia with or without dysplasia in the upper gastrointestinal tract.
20367284 The appearance of CDX-expressing cells in non-metaplastic foci was not associated with the development of IM
20351696 promoter upregulated by HB-EGF stimulation
20298184 Review of evidences for the role of Cdx2 in the development of Barrett's metaplasia.
20298183 Review of the basic pathology of gastric intestinal metaplasia as well as the current knowledge on molecular pathways involved in CDX2 regulation in the gastric context.
20198783 Presented is examination of CDX2 expression at 15 adenomas and 30 colorectal carcinomas. All the adenomas are positive for CDX2, 27 /90%/ of the adenocarcinomas show nuclear expression of CDX2.
20133952 In cooperation with Cdx2, HNF-1alpha acts as a key factor on human intestinal cells to trigger the onset of their functional differentiation program whereas GATA-4 appears to promote morphological changes.
20127720 The present study reports the first characterization of the ELMO3 promoter and suggests a significant role of CDX2 in the basal transcriptional regulation of the intestine-specific expression of ELMO3, possibly through interaction with SP1.
20075618 Studied the DNA binding activity of CDX2. Three CDX2-binding proteins were found in rat gastric tissue, and those proteins were identified to the homeobox protein Hox-D8, LIM homeobox protein 6, and SMC1L1 protein.
20044613 Increased CDX2 expression is associated with cutaneous metastatic carcinomas and extramammary Paget's Disease.
20043087 Cdx2 overexpression can effectively inhibit gastric cancer progression and may be used as a potent therapy.
19820687 Our results indicate that CDX2 expression is associated with specific morphological and mucin phenotypes of gastric epithelial dysplasias, and decreases progressively with the advancing stage of gastric cancers
19817898 nuclear expression of Cdx2 was frequently (90.4%) observed in morular foci in various lesions, and cytoplasmic reactivity was also observed in 20 cases (38.5%), including all five cases without nuclear expression
19795349 Immunohistochemical analysis of CDX2 expression in normal choroid plexus epithelium and choroid plexus tumors is reported.
19782160 Data show that binding of DHS with sequences of HNF1, CDX2, and PBX1 in vitro contribute to understanding of the complexity of cell-type-specific CFTR regulatory mechanisms.
19781065 RNA interference of CDX1 and CDX2 and chromatin immunoprecipitation in colon cancer cells revealed that MS4A12 transcript and protein expression is essentially dependent on the presence of endogenous CDX2.
19762530 The majority of cervical adenocarcinomas of the intestinal type express CDX-2, CDX-2 is also expressed in other histologic types of cervical adenocarcinomas to a lesser extent. Therefore, CDX-2 is not totally specific for colorectal carcinoma
19761587 The HNF4alpha regulation of the Cdx-2 promoter unravels a transcription factor network also including HNF1alpha, all of which are transcription factors involved in intestinal development and gene expression.
19724852 positive expression of both CD44v6 and MMP-7, and negative expression of nuclear Cdx2 may serve as powerful predictors of lymph node metastasis in gastric cancer
19686845 The inhibitory effect of ERK1/2 upon Cdx2 in colorectal cancer cells is in sharp contrast to its stimulatory effect upon Cdx2 expression in trophectoderm and trophoblast stem cells.
19617623 Data show that elevation of cAMP leads to enhanced phosphorylation and nuclear exclusion of Oct-1 and reduced interactions between Oct-1 or nuclear co-repressors and the Cdx-2 gene promoter.
19584150 Data suggest that CDX2 loss may be associated with poor prognosis among patients with a family history of colorectal cancer.
19578052 The positivity of CDX2 in germ cell tumors warrants including yolk sac tumors in the differential diagnosis of adenocarcinoma of unknown origin.
19468668 Our data suggested an important role of CDX1 and CDX2 in the development of Barrett's esophagus
19460469 the study ruled out microdeletions on the critical region as a common cause of Moebius syndrome and excluded CDX2 gene
19449081 The inhibition of nucleostemin expression in "esophageal stem cells" in response to bile acid exposure may be involved in the pathogenesis of BE through upregulating CDX2 expression.
19421714 The aim of this study was to investigate whether genetic variants in CDX2 contributed to the development and progression of colorectal cancer in a Chinese population.
19421714 Observational study of gene-disease association. (HuGE Navigator)
19415720 Increase in CDX2 RNA expression was associated with esophageal adenocarcinoma.
19414376 High CDX2 expression is associated with non-small cell lung cancer.
19383647 role for Cdx-2 vitamin D receptor polymorphism in sun exposure reduction in risk for multiple sclerosis
19371634 Cdx2 regulates intestinal villin expression through recruiting Brm-type SWI/SNF complex to the villin promoter.
19266212 Both solitary and SMAD4 mutated JP case showed extensive co-localization of the alterations described above: decreased expression of SMAD4, CDX2 and partially also MUC2 and de novo expression of MUC5AC.
19251954 Results have shown a distinct up-regulation of CDX2 gene expression in the gastric mucosa of patients with both H pylori infection and GORD.
19218548 CDX2 expression levels may serve as a marker for adverse prognosis in pediatric acute lymphoblastic leukemia
19212618 Osteopontin is a useful prognostic marker in gastric cancer, and combined with CDX2, may have particular advantage for predicting survival of advanced gastric cancer patients
19158837 the proto-oncogene CDX2 is aberrantly expressed in the majority of cases with B-lineage ALL and T-ALL
19106744 Homeobox gene CDX2 inhibits human pancreatic cancer cell proliferation by down-regulating cyclin D1 transcriptional activity.
19098678 CDX2 expression was not influenced by the grade (differentiation) of rectal adenocarcinoma.
19047909 CDX-2 cannot be used to determine if a carcinoid is primary in the ovary or metastatic from the intestine
18992917 Calretinin, MLH-1, and CDX2 may help to differentiate medullary carcinoma from poorly differentiated colonic carcinoma of the colon.
18854960 esophagus intestinal metaplasia may occur via induction of caudal homeobox gene 2 (CDX2) by bile acids due to ligand-dependent transactivation of epidermal growth factor receptor
18843504 Aberrant Cdx2 expression in pyloric gland adenoma of the gallbladder is closely associated with nuclear beta-catenin expression and squamous morule in contrast with intestinal metaplasia.
18754095 Alterations of gastric CDX2 expression in Helicobacter pylori infection, incisural antralisation, and intestinal metaplasia.
18753946 frequency and pattern of CDX2 staining in the more common histologic subtypes of cervical adenocarcinoma is parallel to that which is seen for adenocarcinomas of the upper gastrointestinal tract and pancreaticobiliary system.
18752499 Explanation for diffuse nuclear positivity with intestinal transcription factor CDX2 in endometrioid proliferations of the uterus and ovary is not clear, but may be a result of overexpression of nuclear beta-catenin.
18703641 Stimulation of epithelia by the CaSR increased the expression of the tyrosine kinase Ror2, suggesting existence of a unique paracrine relationship for CDX2 homoeostasis in the intestine.
18587323 Loss of CDX2 and CK20 is more frequently encountered in mismatch repair-deficient colorectal cancer.
18581275 Loss of expression of CDX2 protein may play an important role in the tumorigenesis of colorectal cancers.
18500171 Significant correlations sre found between claudin-2 and Cdx2 protein expression in dysplasia and intestine-type adenocarcinoma.
18495206 The Cdx2 protein is expressed frequently in endometrial lesions with squamous differentiation.
18353622 combined detection of CDH17/CDX2 co-expression may benefit us in predicting the prognosis of gastric carcinoma.
18254783 results suggest that genetic alterations of the Cdx2 gene may contribute to the loss of Cdx2 expression and to the development of gastric cancer, especially in the intestinal-type
18251778 Cdx2 plays an important role in the regulation of intestinal claudin expression not only in gastric mucosa with intestinal metaplasia but also gastric carcinoma.
18250063 The abnormal expression of CDX(2) and E-cadherin plays an important role in the development of gastric carcinoma.
18187048 changes in CDX2 and CDX1 expression determined by methyl group deprivation may constitute one of the mechanisms sustaining the protective role attributed to folate in colon cancer
18184409 combined analysis of Cdx2 and nuclear PTEN expression can have significant value in distinguishing histological types of gastric cancer and assessing prognosis in patients with gastric cancer.
18156982 to distinguish intestinal types of cervical adenocarcinoma from involvement by a colorectal adenocarcinoma...CDX2 is of no value in this regard
18051367 HIV-1 Tat downregulates caudal type homeobox 2 in HEK 293T cells
18038313 In addition to CDX2 and MUC2 antibodies, HepPar-1 immunoexpression seems to have a potential role in differential diagnosis of periampullary adenocarcinomas.
17957487 The down-regulation of CDX-2 may be an important mechanism in the induction of the Ulcer-associated cell lineage in Crohn's disease.
17906616 Intestinal metaplasia or dysplasia with low expression of CDX2 may serve as predictive markers for gastric cancer.
17876541 CDX2 inhibits transcription of Cox-2 by interfering with the binding of NF-kappaB on the NF-kappaB binding site.
17855634 potential role of CDX2 in the development of human acute myeloid leukemia with aberrant Hox gene expression
17852856 Bile acids induce overexpression of homeobox gene CDX-2 in human Barrett's esophageal mucosa and adenocarcinoma cell line.
17614034 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17614034 In postmenopausal women, the Cdx-2 polymorphism does not influence bone mineral density by itself, but does affect bone mineral density in response to physical activity.
17599044 Cdx2 opposes colon cancer cell migration and dissemination. Forced expression of Cdx2 in human colon cancer cell lines retards wound repair and reduces migration.
17549351 High CDX2 is associated with colorectal adenocarcinoma metastases
17534889 inactivation of CDX2 in esophageal cancer associated with DNA methylation may be an important determinant of the squamous or non-adenomatous phenotype.
17468517 an association between Cdx2 and beta-catenin signaling may participate in induction of transdifferentiation of differentiation in endometrial cancer cells.
17297462 CDX2 can function as a transcriptional repressor, and one mechanism by which CDX2 promotes anchorage-independent growth is by transcriptional repression of IGFBP-3.
16996572 Results showed that 10.7% (11/103) of nontumorous gallbladders resected because of cholelithiasis revealed intestinal metaplasia with Cdx2 expression.
16963449 leptin, which is increased in inflamed colonic mucosa, triggers colonic expression of hPepT1 via the CREB and Cdx2 transcription factors
16831200 Based on these results, we hypothesize that Cdx2 is involved in activating Math1 expression in intestinal epithelial cells.
16794828 CDX2 expression was observed in 22 of the 59 (37.3%) cholangiocarcinoma cases, and was much higher in papillary-type than tubular-type cholangiocarcinoma (P = 0.002).
16788384 Cdx2 was shown to cooperatively activate the UGT2B7 promoter in conjunction with hepatocyte nuclear factor 1alpha (HNF1alpha), a mechanism previously observed to regulate other intestine-specific genes.
16618413 Transformation associated with reflux at the gastroesophageal junction reflects activation by bile acid and acid of a transcriptional program involving NF-kappaB and Cdx2, which mediate intestinal metaplasia and ectopic expression of GC-C.
16509871 CDX-2 expression in stomach cancer may be a marker of the progression of gastric carcinogenesis, and that its activation may represent an early event.
16480684 Cdx2 requires additional factors to activate the enterocyte differentiation program in normal undifferentiated cells
16361536 The loss of Cdx2 expression or transcriptional activity is an infrequent event during tumorigenesis, which does not contribute to molecular mechanisms underlying initiation and progression of most colorectal tumors.
16331267 disruption of CDX2 in MKN45 cells does not significantly affect their tumorigenic potential
16291394 CDX2 mRNA and CDX2 protein expression are upregulated in Barrett's IM tissues, compared with normal squamous esophagus, and remain elevated in dysplasia and adenocarcinoma tissues
16144916 Higher expression of Cdx2 is associated with intestinal-type carcinomas
16027724 Phosphorylation of CDX2 mediates its ubiquitin-dependent proteasome degradation.
15994917 Observational study of gene-disease association. (HuGE Navigator)
15994917 CDX2 expression levels were strongly associated with microsatellite instability and tumor location in the gastrointestinal tract, consistent with a possible role in the specification of gastrointestinal epithelial cell fate in humans.
15894926 marker for cellular phenotype in sinonasal intestinal-type adenocarcinoma
15782100 Aberrant expression of cdx2 homeobox gene was detected in pancreatic intraductal papillary mucinous neoplasm but not in ductal adenocarcinoma
15774940 Cdx1 activates the IAP gene via a novel cis element, whereas Cdx2 inhibits the Cdx1 effects
15722794 Study suggests that CDX2 is a relatively specific marker for tumors with intestinal differentiation; it can be seen in large cell and adenocarcinomas of the lung.
15645288 CDX2 plays an important role in gallbladder carcinogenesis with intestinal differentiation.
15619975 the major factors determining the presence of CDX-2 in colorectal carcinomas at the protein product level may include cancer location and the solid phenotype of the tumor.
15547744 Cdx2 expression in invasive ductal carcinomas may be a novel prognostic marker for patient survival.
15517368 CDX2 may be considered a sensitive and specific marker of midgut serotonin-producing /EC/-cells and EC-cell tumors, and its expression may be useful in the diagnosis of metastases from occult ETs
15466189 There is a transient loss of Cdx2 in budding tumor cells at the tumor host interface in colorectal cancer, and reexpression of Cdx2 in metastases.
15362373 a sensitive and specific marker for differentiating metastatic colorectal adenocarcinoma from mucinous bronchioloalveolar adenocarcinoma.
15327990 identification of MOK, a member of the mitogen-activated protein kinase superfamily, as one of the genes induced by a caudal-related homeobox transcription factor, Cdx2
15240568 CDX2 and MUC2 genes are repressed by SOX9 in intestinal epithelium
15217781 Cdx-2 is a permissive factor that influences basal CaBP expression in enterocytes and that HNF-1alpha modulates CaBP gene expression during cellular differentiation.
15215241 Cdx1 and Cdx2 inhibit colon cancer cell proliferation by blocking beta-catenin/TCF transcriptional activity
15205684 CDX2 is a sensitive and specific marker for colorectal adenocarcinoma.
15190067 APC and CDX2 have roles in controlling retinoic acid biosynthesis and in promoting a retinoid-induced program of colonocyte differentiation
15167938 Cdx2 is a highly sensitive marker for Barrett's esophagus.
15048136 Aberrant expression of CDX2 is closely related to the overexpression of MUC2 in mucinous intrahepatic cholangiocarcinoma and intraductal papillary neoplasia of the liver associated with hepatolithiasis.
14615935 These results show that Cdx1 and Cdx2 might be indispensable for intestinal phenotypic expression even in gastric cancer cells
14576477 Cdx2 protein is a sensitive marker of intestinal metaplasia in the upper gastrointestinal tract and may be useful in detecting histologically equivocal cases of Barrett's esophagus.
14557879 results suggest that Cdx2 is a useful prognostic marker for gastric cancer; advanced gastric cancers with both intestinal and gastric phenotypic expression have a relatively good prognosis
14525978 Cdx-2 activates the expression of MUC2 mucin gene in gastric cells, inducing an intestinal transdifferentiation phenotype that parallels what is observed both in intestinal metaplasia and some gastric carcinomas
12970742 p21 is a transcriptional target of CDX2. Our results may thus provide a new mechanism underlying the functions of CDX2.
12968672 A Cdx-2 binding site polymorphism (G to A) in the promoter region of the vitamin D receptor gene was reported. investigated the relationship between the VDR Cdx-2 genotype and risk of fracture
12947088 findings suggest caudal type homeo box transcription factor 2(CDX2) inactivation in colon cancer results from defects in trans-acting pathways regulating CDX2 transcription, and CDX2 silencing contributes to altered phenotype of some colorectal cancers
12559945 These results suggest that CDX2, but not CDX1, interacts with the MUC2 promoter and activates MUC2 transcription, and plays an important role in the differentiation of goblet cells.
12270138 The homeobox gene belongs to the p53-p21(WAF)-Bcl-2 network in intestinal epithelial cells
11871772 expression of CDX2 precedes expression of CDX1 during the progression of intestinal metaplasia;expression of CDX2 may trigger the initiation and development of intestinal metaplasia
11846061 Increased CDX2 mRNA is associated with chronic atrophic gastritis
11733373 Markedly reduced or absent CDX2 expression was noted by immunohistochemistry in 13 of 15 (87%) large cell minimally differentiated carcinomas (LCMDCs), whereas only 1 of the 25 (4%) differentiated adenocarcinomas (DACs)showed reduced CDX2 expression.

AA Sequence

MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYG      1 - 70
APLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTL     71 - 140
NPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRY    141 - 210
ITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPE    211 - 280
PLSPVSSLQASVPGSVPGVLGPTGGVLNPTVTQ                                         281 - 313
//

Text Mined References (258)

PMID Year Title
26926447 2016 Increasing diagnostic accuracy to grade dysplasia in Barrett's esophagus using an immunohistochemical panel for CDX2, p120ctn, c-Myc and Jagged1.
26902420 2016 Distinct mechanisms for opposite functions of homeoproteins Cdx2 and HoxB7 in double-strand break DNA repair in colon cancer cells.
26841784 2016 Follow-Up Study on CDX1 and CDX2 mRNA Expression in Noncancerous Gastric Mucosae After Helicobacter pylori Eradication.
26789870 2016 CDX2 as a Prognostic Biomarker in Stage II and Stage III Colon Cancer.
26772394 2016 The utility of CDX2, GATA3, and DOG1 in the diagnosis of testicular neoplasms: an immunohistochemical study of 109 cases.
26759244 2016 Cdx2 Expression and Intestinal Metaplasia Induced by H. pylori Infection of Gastric Cells Is Regulated by NOD1-Mediated Innate Immune Responses.
26743476 2016 Inactivation of NKX6.3 in the stomach leads to abnormal expression of CDX2 and SOX2 required for gastric-to-intestinal transdifferentiation.
26551082 2016 CDX2 downregulation is associated with poor differentiation and MMR deficiency in colon cancer.
26469326 2016 CDX-2 Expression in Primary Lung Adenocarcinoma.
26346470 2015 Vitamin D receptor Cdx-2-dependent response of central obesity to vitamin D intake in the subjects with type 2 diabetes: a randomised clinical trial.
26238762 2015 Nuclear transcription factor CDX2 inhibits gastric cancer?cell growth and reverses epithelial?to?mesenchymal transition in vitro and in vivo.
26229399 2015 Association of hepatocyte-derived growth factor receptor/caudal type homeobox 2 co-expression with mucosal regeneration in active ulcerative colitis.
26030973 [Role of transcription factors in transdifferentiation of the gastric mucosa].
26005051 2015 Overexpression of caudal-related homeobox transcription factor 2 inhibits the growth of transplanted colorectal tumors in nude mice.
25989273 2015 Validation of histomolecular classification utilizing histological subtype, MUC1, and CDX2 for prognostication of resected ampullary adenocarcinoma.
25867765 2015 CDX2 homeoprotein is involved in the regulation of ST6GalNAc-I gene in intestinal metaplasia.
25849303 2015 Cdx2 polymorphism affects the activities of vitamin D receptor in human breast cancer cell lines and human breast carcinomas.
25799416 2015 Vitamin D receptor Cdx-2 polymorphism and premenopausal breast cancer risk in southern Pakistani patients.
25759548 2015 CDX2 protein expression compared to alcian blue staining in the evaluation of esophageal intestinal metaplasia.
25738688 2016 Meta-analysis on vitamin D receptor and cancer risk: focus on the role of TaqI, ApaI, and Cdx2 polymorphisms.
25738600 2015 Overexpression of caudal type homeobox transcription factor 2 inhibits the growth of the MGC-803 human gastric cancer cell line in vivo.
25663765 2015 Loss of CDX2 expression is associated with poor prognosis in colorectal cancer patients.
25300947 2014 Immunohistochemical molecular phenotypes of gastric cancer based on SOX2 and CDX2 predict patient outcome.
25196071 2015 Differentiation reprogramming in gastric intestinal metaplasia and dysplasia: role of SOX2 and CDX2.
25171776 2014 CDX2 enhances HTR-8/SVneo trophoblast cell invasion by altering the expression of matrix metalloproteinases.
25138215 2014 Transcriptional regulation of the intestinal nuclear bile acid farnesoid X receptor (FXR) by the caudal-related homeobox 2 (CDX2).
25131200 2014 A polymorphic enhancer near GREM1 influences bowel cancer risk through differential CDX2 and TCF7L2 binding.
25101906 2014 A novel CDX2 isoform regulates alternative splicing.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
25081540 2014 Comparison between the location and the histomorphological/immunohistochemical characteristics of noninvasive neoplasms of the ampulla of Vater.
25042702 2014 NANOG and CDX2 pattern distinct subtypes of human mesoderm during exit from pluripotency.
24974686 2014 Immunohistochemistry for CDX2 expression in non-goblet-cell Barrett's oesophagus.
24953186 2014 CDX2 can be regulated through the signalling pathways activated by IL-6 in gastric cells.
24908142 2014 BRAF-mutated microsatellite stable colorectal carcinoma: an aggressive adenocarcinoma with reduced CDX2 and increased cytokeratin 7 immunohistochemical expression.
24841154 2014 CDX2 gene expression in acute lymphoblastic leukemia.
24814920 2014 The role of CDX2 in inflammatory bowel disease.
24794431 2014 A pSMAD/CDX2 complex is essential for the intestinalization of epithelial metaplasia.
24744585 2014 New insights into the functions and localization of the homeotic gene CDX2 in gastric cancer.
24603585 2014 Prognostic significance of CDX2 and mucin expression in small intestinal adenocarcinoma.
24501326 2014 Involvement of CDX2 in the cross talk between TNF-? and Wnt signaling pathway in the colon cancer cell line Caco-2.
24489794 2014 Utilization of CDX2 expression in diagnosing pancreatic ductal adenocarcinoma and predicting prognosis.
24287273 H. pylori-encoded CagA disrupts tight junctions and induces invasiveness of AGS gastric carcinoma cells via Cdx2-dependent targeting of Claudin-2.
24266897 2014 BAI3, CDX2 and VIL1: a panel of three antibodies to distinguish small cell from large cell neuroendocrine lung carcinomas.
24166180 2014 Possible role of Cdx2 in the serrated pathway of colorectal cancer characterized by BRAF mutation, high-level CpG Island methylator phenotype and mismatch repair-deficiency.
24103759 2013 Thyroid hormone negatively regulates CDX2 and SOAT2 mRNA expression via induction of miRNA-181d in hepatic cells.
24025523 2013 Loss of CDX2/CK20 expression is associated with poorly differentiated carcinoma, the CpG island methylator phenotype, and adverse prognosis in microsatellite-unstable colorectal cancer.
23958315 2013 The role of CDX2 in Caco-2 cell differentiation.
23918153 2014 Single nucleotide polymorphisms of caudal type homeobox 1 and 2 are associated with Barrett's esophagus.
23887079 2013 Embryonic transcription factors CDX2 and Oct4 are overexpressed in neuroendocrine tumors of the ileum: a pilot study.
23864778 2013 Reversal of multidrug resistance in gastric cancer cells by CDX2 downregulation.
23846317 2014 Among sinonasal tumors, CDX-2 immunoexpression is not restricted to intestinal-type adenocarcinomas.
23834763 2013 Intestinal and pancreatobiliary differentiation in periampullary carcinoma: the role of immunohistochemistry.
23828549 2014 Mucin phenotype expression of gastric neuroendocrine neoplasms: analysis of histopathology and carcinogenesis.
23734674 2013 CDX2 expression in columnar variant of papillary thyroid carcinoma.
23649760 2013 The Cdx-2 polymorphism in the VDR gene is associated with increased risk of cancer: a meta-analysis.
23613102 2013 Dysregulation of CDX1, CDX2 and SOX2 in patients with gastric cancer also affects the non-malignant mucosa.
23574843 2013 Reduced CDX2 expression predicts poor overall survival in patients with colorectal cancer.
23568430 2013 Disturbed balance between SOX2 and CDX2 in human vitelline duct anomalies and intestinal duplications.
23546539 2013 PTEN expression and suppression of proliferation are associated with Cdx2 overexpression in gastric cancer cells.
23545100 2013 Expression and functional role of Cdx2 in intestinal metaplasia of cystitis glandularis.
23488912 2013 Columnar cell variant of papillary thyroid carcinoma: a study of 10 cases with emphasis on CDX2 expression.
23439753 2013 Histomolecular phenotypes and outcome in adenocarcinoma of the ampulla of vater.
23393221 2013 Regulation of APC and AXIN2 expression by intestinal tumor suppressor CDX2 in colon cancer cells.
23384906 2012 [Expression level of CDX2 gene in acute myeloid leukemia and its clinical significance].
23382633 2013 Cdx2 expression and its promoter methylation during metaplasia-dysplasia-carcinoma sequence in Barrett's esophagus.
23317240 2012 No association between the CDX2 G543C polymorphism and risk of gastric atrophy and cancer.
23313847 2013 Roles of CDX2 and EOMES in human induced trophoblast progenitor cells.
23202735 2013 CDX2-driven leukemogenesis involves KLF4 repression and deregulated PPAR? signaling.
23181722 2012 Prognostic significance of Cdx2 immunohistochemical expression in gastric cancer: a meta-analysis of published literatures.
23133598 2012 Reg IV is a direct target of intestinal transcriptional factor CDX2 in gastric cancer.
23127929 2012 [Identity and intestinal pathologies: the Cdx2 homeotic gene].
23112155 2012 CDX2 is an amplified lineage-survival oncogene in colorectal cancer.
23105122 2013 Is CDX2 immunostaining useful for delineating anorectal from penile/vulvar squamous cancer in the setting of squamous cell carcinoma with clinically unknown primary site presenting with histologically confirmed inguinal lymph node metastasis?
23026509 2013 Vitamin D status and the Cdx-2 polymorphism of the vitamin D receptor gene are determining factors of bone mineral density in young healthy postmenopausal women.
23011828 2012 CDX2, COX2 and MUC2 expressions in Barrett's esophagus: can they be useful in determination of the dysplasia?
22895825 2012 CDX-2 expression in malignant germ cell tumors of the testes, intratubular germ cell neoplasia, and normal seminiferous tubules.
22895272 2012 Histomorphologic and molecular features of pouch and peripouch adenocarcinoma: a comparison with ulcerative colitis-associated adenocarcinoma.
22892849 2012 CDX2 serves as a Wnt signaling inhibitor and is frequently methylated in lung cancer.
22829163 2013 Re-evaluation of phenotypic expression in undifferentiated-type early gastric adenocarcinomas using mucin core protein and CDX2.
22824143 2012 Ephrin-A1 inhibits NSCLC tumor growth via induction of Cdx-2 a tumor suppressor gene.
22810971 2012 Up-regulation of cadherin 17 and down-regulation of homeodomain protein CDX2 correlate with tumor progression and unfavorable prognosis in epithelial ovarian cancer.
22791809 2012 Helicobacter pylori and the BMP pathway regulate CDX2 and SOX2 expression in gastric cells.
22783055 2012 Expression and significance of homeodomain protein Cdx2 in gastric carcinoma and precancerous lesions.
22719836 2012 Caudal homeobox protein Cdx-2 cooperates with Wnt pathway to regulate claudin-1 expression in colon cancer cells.
22671145 2012 Transcriptional networks driving enhancer function in the CFTR gene.
22580340 2012 Constitutive expression of an antioxidant enzyme, glutathione S-transferase P1, during differentiation of human intestinal Caco-2 cells.
22563170 2012 siRNA targeting of Cdx2 inhibits growth of human gastric cancer MGC-803 cells.
22547830 2012 Transcription factors c-Myc and CDX2 mediate E-selectin ligand expression in colon cancer cells undergoing EGF/bFGF-induced epithelial-mesenchymal transition.
22523209 2012 CDX2 expression in columnar cell variant of papillary thyroid carcinoma.
22502678 2012 Expression of CDX2 and villin in gastric cardiac intestinal metaplasia and the relation with gastric cardiac carcinogenesis.
22495359 2012 IMP3, NESP55, TTF-1 and CDX2 serve as an immunohistochemical panel in the distinction among small-cell carcinoma, gastrointestinal carcinoid, and pancreatic endocrine tumor metastasized to the liver.
22449796 2012 Notch signaling pathway and Cdx2 expression in the development of Barrett's esophagus.
22438068 2012 Loss of desmocollin 1-3 and homeobox genes PITX1 and CDX2 are associated with tumor progression and survival in colorectal carcinoma.
22407102 2012 Determinants of gastric CDX2 expression: a study in Mozambique.
22364879 2012 Differentiation of Caco-2 cells requires both transcriptional and post-translational down-regulation of Myc.
22326557 2012 TNF-?-induced down-regulation of CDX2 suppresses MEP1A expression in colitis.
22268990 2012 The value of CDX2 and cytokeratins 7 and 20 expression in differentiating colorectal adenocarcinomas from extraintestinal gastrointestinal adenocarcinomas: cytokeratin 7-/20+ phenotype is more specific than CDX2 antibody.
22261707 2012 Divergent expression of MUC5AC, MUC6, MUC2, CD10, and CDX-2 in dysplasia and intramucosal adenocarcinomas with intestinal and foveolar morphology: is this evidence of distinct gastric and intestinal pathways to carcinogenesis in Barrett Esophagus?
22202456 2012 Cdx2 controls expression of the protocadherin Mucdhl, an inhibitor of growth and ?-catenin activity in colon cancer cells.
22078291 2012 Relationship between alpha-methylacyl-coenzyme A racemase expression and mucin phenotype in gastric cancer.
22076569 2012 Activation of the BMP4 pathway and early expression of CDX2 characterize non-specialized columnar metaplasia in a human model of Barrett's esophagus.
22016432 2012 Regulation of the gene encoding the intestinal bile acid transporter ASBT by the caudal-type homeobox proteins CDX1 and CDX2.
21909647 2011 The relationship among PDX1, CDX2, and mucin profiles in gastric carcinomas; correlations with clinicopathologic parameters.
21903586 2011 miR-125b, a target of CDX2, regulates cell differentiation through repression of the core binding factor in hematopoietic malignancies.
21816365 2011 BRACHYURY and CDX2 mediate BMP-induced differentiation of human and mouse pluripotent stem cells into embryonic and extraembryonic lineages.
21739268 2011 Hormonally defined pancreatic and duodenal neuroendocrine tumors differ in their transcription factor signatures: expression of ISL1, PDX1, NGN3, and CDX2.
21572312 2011 Immunohistochemical analysis in a morphologic spectrum of urachal epithelial neoplasms: diagnostic implications and pitfalls.
21532856 2011 CDX1 and CDX2 expression in intestinal metaplasia, dysplasia and gastric cancer.
21518475 2011 [Expression and clinical significance of caudal type homeobox transcription factor-2 in adult acute lymphocytic leukemia].
21364588 2011 Clinical significance of CDX2-positive circulating tumour cells in colorectal cancer patients.
21362237 2011 [Expression of cdx2 gene in pediatric patients with leukemia and its clinical significance].
21284881 2011 Mechanisms of confluence-dependent expression of CD26 in colon cancer cell lines.
21225631 2011 MiR-9 downregulates CDX2 expression in gastric cancer cells.
21224344 2011 Suppression of colonic polyposis by homeoprotein CDX2 through its nontranscriptional function that stabilizes p27Kip1.
21221877 2011 Expression of CDX2 and hepatocyte antigen in benign and malignant lesions of gallbladder and its correlation with histopathologic type and clinical outcome.
21221798 2011 Endoscopic diagnosis of open-type atrophic gastritis is related to the histological diagnosis of intestinal metaplasia and Cdx2 expression.
21074721 2010 Differentiation-specific histone modifications reveal dynamic chromatin interactions and partners for the intestinal transcription factor CDX2.
20699370 2010 CDX2 regulates multidrug resistance 1 gene expression in malignant intestinal epithelium.
20696899 2010 TCF4 and CDX2, major transcription factors for intestinal function, converge on the same cis-regulatory regions.
20671195 2010 Intestine-specific transcription factor Cdx2 induces E-cadherin function by enhancing the trafficking of E-cadherin to the cell membrane.
20658368 2010 [Significance of IL-1beta-induced ectopic expression of CDX2 in the intestinal metaplasia of gastric epithelium].
20619754 2011 Expression of Sonic hedgehog (SHH) and CDX2 in the columnar epithelium of the lower oesophagus.
20602288 2010 Pituitary adenomas and craniopharyngiomas are CDX2 negative neoplasms.
20551175 2010 Cdx2 regulates endo-lysosomal function and epithelial cell polarity.
20518411 Utility of thyroid transcription factor-1 and CDX-2 in determining the primary site of metastatic adenocarcinomas in serous effusions.
20514449 2010 Hypoxia-inducible factor-1alpha modulates the down-regulation of the homeodomain protein CDX2 in colorectal cancer.
20444732 2010 CDX2 and LI-cadherin expression in esophageal mucosa: use of both markers can facilitate the histologic diagnosis of Barrett's esophagus and carcinoma.
20367284 2010 Relevance of high virulence Helicobacter pylori strains and futility of CDX2 expression for predicting intestinal metaplasia after eradication of infection.
20351696 2010 Fibroblast-derived HB-EGF promotes Cdx2 expression in esophageal squamous cells.
20298184 2010 The role of Cdx2 in Barrett's metaplasia.
20298183 2010 Pathophysiology of intestinal metaplasia of the stomach: emphasis on CDX2 regulation.
20198783 2009 [CDX2--an immunochystochemistry marker of intestinal differentiation of adenocarcinomas].
20133952 2010 Cooperation between HNF-1alpha, Cdx2, and GATA-4 in initiating an enterocytic differentiation program in a normal human intestinal epithelial progenitor cell line.
20127720 2010 Control of intestinal promoter activity of the cellular migratory regulator gene ELMO3 by CDX2 and SP1.
20075618 2009 Purification of caudal-related homeodomain transcription factor and its binding characterization.
20044613 2009 CDX2 expression in cutaneous metastatic carcinomas and extramammary Paget's Disease.
20043087 2010 Overexpression of Cdx2 inhibits progression of gastric cancer in vitro.
19820687 2010 CDX2 expression in the intestinal-type gastric epithelial neoplasia: frequency and significance.
19817898 2009 Aberrant nuclear Cdx2 expression in morule-forming tumours in different organs, accompanied by cytoplasmic reactivity.
19795349 2009 Immunohistochemical analysis of CDX2 expression in normal choroid plexus epithelium and choroid plexus tumors.
19782160 Interaction of intestinal and pancreatic transcription factors in the regulation of CFTR gene expression.
19781065 2009 Selective activation of tumor growth-promoting Ca2+ channel MS4A12 in colon cancer by caudal type homeobox transcription factor CDX2.
19762530 2009 CDX-2 expression is a common event in primary intestinal-type endocervical adenocarcinoma.
19761587 2009 Mapping of HNF4alpha target genes in intestinal epithelial cells.
19724852 2009 CD44v6, MMP-7 and nuclear Cdx2 are significant biomarkers for prediction of lymph node metastasis in primary gastric cancer.
19686845 2009 Down-regulation of Cdx2 in colorectal carcinoma cells by the Raf-MEK-ERK 1/2 pathway.
19617623 2009 POU homeodomain protein Oct-1 functions as a sensor for cyclic AMP.
19584150 2009 Relationship of CDX2 loss with molecular features and prognosis in colorectal cancer.
19578052 2009 CDX2 expression in yolk sac component of testicular germ cell tumors.
19468668 2009 Differential gene expression in normal esophagus and Barrett's esophagus.
19460469 Molecular genetic screening of MBS1 locus on chromosome 13 for microdeletions and exclusion of FGF9, GSH1 and CDX2 as causative genes in patients with Moebius syndrome.
19449081 2009 Inhibition of nucleostemin upregulates CDX2 expression in HT29 cells in response to bile acid exposure: implications in the pathogenesis of Barrett's esophagus.
19421714 2009 No association between the polymorphisms in CDX2 coding regions and colorectal cancer in Chinese.
19415720 2009 Regulation of CDX2 expression in esophageal adenocarcinoma.
19414376 2009 The role of the homeobox genes BFT and CDX2 in the pathogenesis of non-small cell lung cancer.
19383647 2009 Past environmental sun exposure and risk of multiple sclerosis: a role for the Cdx-2 Vitamin D receptor variant in this interaction.
19371634 2009 Cdx2 and the Brm-type SWI/SNF complex cooperatively regulate villin expression in gastrointestinal cells.
19266212 2009 Juvenile polyps have gastric differentiation with MUC5AC expression and downregulation of CDX2 and SMAD4.
19251954 2009 The combined presence of H pylori infection and gastro-oesophageal reflux disease leads to an up-regulation of CDX2 gene expression in antrum and cardia.
19218548 2009 Aberrant expression of the homeobox gene CDX2 in pediatric acute lymphoblastic leukemia.
19212618 2009 Expression of osteopontin and CDX2: indications of phenotypes and prognosis in advanced gastric cancer.
19158837 2009 The homeobox gene CDX2 is aberrantly expressed and associated with an inferior prognosis in patients with acute lymphoblastic leukemia.
19106744 2009 Homeobox gene CDX2 inhibits human pancreatic cancer cell proliferation by down-regulating cyclin D1 transcriptional activity.
19098678 2009 CDX2, cytokeratins 7 and 20 immunoreactivity in rectal adenocarcinoma.
19047909 2009 Primary ovarian carcinoid tumors may express CDX-2: a potential pitfall in distinction from metastatic intestinal carcinoid tumors involving the ovary.
18992917 2009 Differentiating the undifferentiated: immunohistochemical profile of medullary carcinoma of the colon with an emphasis on intestinal differentiation.
18854960 2009 Bile acid alone, or in combination with acid, induces CDX2 expression through activation of the epidermal growth factor receptor (EGFR).
18843504 2008 Aberrant expression of an "intestinal marker" Cdx2 in pyloric gland adenoma of the gallbladder.
18754095 2009 Alterations of gastric homeoprotein expression in Helicobacter pylori infection, incisural antralisation, and intestinal metaplasia.
18753946 2008 Comprehensive evaluation of CDX2 in invasive cervical adenocarcinomas: immunopositivity in the absence of overt colorectal morphology.
18752499 2008 Morules in endometrioid proliferations of the uterus and ovary consistently express the intestinal transcription factor CDX2.
18703641 2008 CaSR stimulates secretion of Wnt5a from colonic myofibroblasts to stimulate CDX2 and sucrase-isomaltase using Ror2 on intestinal epithelia.
18587323 2008 Differential diagnostic and functional role of the multi-marker phenotype CDX2/CK20/CK7 in colorectal cancer stratified by mismatch repair status.
18581275 2008 Expression of homeodomain protein CDX2 in colorectal adenoma and adenocarcinoma.
18500171 2007 Expression of Cdx2 and claudin-2 in the multistage tissue of gastric carcinogenesis.
18495206 2008 Aberrant Cdx2 expression in endometrial lesions with squamous differentiation: important role of Cdx2 in squamous morula formation.
18353622 2008 A clinicopathological study on the expression of cadherin-17 and caudal-related homeobox transcription factor (CDX2) in human gastric carcinoma.
18254783 2008 Genetic alterations of the Cdx2 gene in gastric cancer.
18251778 2008 Cdx2 transcription factor regulates claudin-3 and claudin-4 expression during intestinal differentiation of gastric carcinoma.
18250063 2008 [Expressions of homeobox transcription factor-2 and E-cadherin in gastric carcinoma and their clinical significance].
18187048 2008 Differential regulation of CDX1 and CDX2 gene expression by deficiency in methyl group donors.
18184409 2007 Homeoprotein Cdx2 and nuclear PTEN expression profiles are related to gastric cancer prognosis.
18156982 2008 Intestinal-type cervical adenocarcinoma in situ and adenocarcinoma exhibit a partial enteric immunophenotype with consistent expression of CDX2.
18038313 2008 Does HepPar-1 immunoexpression have a role in differential diagnosis of periampullary cancer?
17957487 2008 Altered expression of CDX-2, PDX-1 and mucin core proteins in "Ulcer-associated cell lineage (UACL)" in Crohn's disease.
17906616 2007 CDX2 expression is progressively decreased in human gastric intestinal metaplasia, dysplasia and cancer.
17876541 2007 Homeobox protein CDX2 reduces Cox-2 transcription by inactivating the DNA-binding capacity of nuclear factor-kappaB.
17855634 2008 Overexpression of CDX2 perturbs HOX gene expression in murine progenitors depending on its N-terminal domain and is closely correlated with deregulated HOX gene expression in human acute myeloid leukemia.
17852856 2007 Bile acids induce overexpression of homeobox gene CDX-2 and vascular endothelial growth factor (VEGF) in human Barrett's esophageal mucosa and adenocarcinoma cell line.
17614034 2007 Physical activity, Cdx-2 genotype, and BMD.
17599044 2008 The intestine-specific homeobox gene Cdx2 decreases mobility and antagonizes dissemination of colon cancer cells.
17549351 2007 CDX2 as a useful marker of colorectal adenocarcinoma metastases to lung in pre-operative biopsy specimens.
17534889 2007 Epigenetic silencing of CDX2 is a feature of squamous esophageal cancer.
17468517 2007 A functional role of Cdx2 in beta-catenin signaling during transdifferentiation in endometrial carcinomas.
17297462 2007 CDX2 promotes anchorage-independent growth by transcriptional repression of IGFBP-3.
16996572 2007 A close relationship between intestinal metaplasia and Cdx2 expression in human gallbladders with cholelithiasis.
16963449 2007 Leptin transcriptionally enhances peptide transporter (hPepT1) expression and activity via the cAMP-response element-binding protein and Cdx2 transcription factors.
16831200 2006 The intestine-specific homeobox gene Cdx2 induces expression of the basic helix-loop-helix transcription factor Math1.
16794828 2006 Expression of phosphorylated ERK1/2 and homeodomain protein CDX2 in cholangiocarcinoma.
16788384 2006 The caudal-related homeodomain protein Cdx2 and hepatocyte nuclear factor 1alpha cooperatively regulate the UDP-glucuronosyltransferase 2B7 gene promoter.
16618413 2006 Bile acids induce ectopic expression of intestinal guanylyl cyclase C Through nuclear factor-kappaB and Cdx2 in human esophageal cells.
16509871 2006 CDX-2 homeobox gene expression in human gastric carcinoma and precursor lesions.
16480684 2006 Cdx2 modulates proliferation in normal human intestinal epithelial crypt cells.
16361536 2005 The putative tumor suppressor Cdx2 is overexpressed by human colorectal adenocarcinomas.
16331267 2006 CDX2 does not suppress tumorigenicity in the human gastric cancer cell line MKN45.
16291394 2005 Increased CDX2 and decreased PITX1 homeobox gene expression in Barrett's esophagus and Barrett's-associated adenocarcinoma.
16144916 2005 Expression of Cdx2 and hepatocyte antigen in gastric carcinoma: correlation with histologic type and implications for prognosis.
16027724 2005 Phosphorylation of the homeotic tumor suppressor Cdx2 mediates its ubiquitin-dependent proteasome degradation.
15994917 2005 CDX2 polymorphisms, RNA expression, and risk of colorectal cancer.
15894926 2005 Expression of CDX2, cytokeratins 7 and 20 in sinonasal intestinal-type adenocarcinoma.
15782100 2005 Aberrant expression of cdx2 homeobox gene in intraductal papillary-mucinous neoplasm of the pancreas but not in pancreatic ductal adenocarcinoma.
15774940 2005 Differential regulation of intestinal alkaline phosphatase gene expression by Cdx1 and Cdx2.
15722794 2005 CDX2 immunostaining as a gastrointestinal marker: expression in lung carcinomas is a potential pitfall.
15677472 2005 Cdx binding determines the timing of enhancer activation in postnatal duodenum.
15645288 2005 Expression of homeodomain protein CDX2 in gallbladder carcinomas.
15619975 2004 CDX-2 expression is reduced in colorectal carcinomas with solid growth pattern and proximal location, but is largely independent of MSI status.
15547744 2004 Cdx2 expression in pancreatic tumors: Relationship with prognosis of invasive ductal carcinomas.
15517368 2004 CDX2 as a marker of intestinal EC-cells and related well-differentiated endocrine tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466189 2004 Down-regulation of the homeodomain factor Cdx2 in colorectal cancer by collagen type I: an active role for the tumor environment in malignant tumor progression.
15362373 2004 Usefulness of Cdx2 in separating mucinous bronchioloalveolar adenocarcinoma of the lung from metastatic mucinous colorectal adenocarcinoma.
15327990 2004 Cdx2 homeodomain protein regulates the expression of MOK, a member of the mitogen-activated protein kinase superfamily, in the intestinal epithelial cells.
15240568 2004 SOX9 is an intestine crypt transcription factor, is regulated by the Wnt pathway, and represses the CDX2 and MUC2 genes.
15217781 2004 Control of differentiation-induced calbindin-D9k gene expression in Caco-2 cells by cdx-2 and HNF-1alpha.
15215241 2004 Cdx1 inhibits human colon cancer cell proliferation by reducing beta-catenin/T-cell factor transcriptional activity.
15205684 2004 The homeobox intestinal differentiation factor CDX2 is selectively expressed in gastrointestinal adenocarcinomas.
15190067 2004 The tumor suppressor adenomatous polyposis coli and caudal related homeodomain protein regulate expression of retinol dehydrogenase L.
15167938 2004 Expression of the intestinal marker Cdx2 in the columnar-lined esophagus with and without intestinal (Barrett's) metaplasia.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15048136 2004 Aberrant expression of CDX2 is closely related to the intestinal metaplasia and MUC2 expression in intraductal papillary neoplasm of the liver in hepatolithiasis.
14615935 2004 Expression of the intestine-specific transcription factors, Cdx1 and Cdx2, correlates shift to an intestinal phenotype in gastric cancer cells.
14576477 2003 Cdx2 as a marker of epithelial intestinal differentiation in the esophagus.
14557879 2003 Expression of Cdx2 and the phenotype of advanced gastric cancers: relationship with prognosis.
14525978 2003 Human MUC2 mucin gene is transcriptionally regulated by Cdx homeodomain proteins in gastrointestinal carcinoma cell lines.
13679455 2003 Cdx2 protein expression in normal and malignant human tissues: an immunohistochemical survey using tissue microarrays.
12970742 2003 CDX2, a homeobox transcription factor, upregulates transcription of the p21/WAF1/CIP1 gene.
12968672 2003 Cdx-2 polymorphism in the promoter region of the human vitamin D receptor gene determines susceptibility to fracture in the elderly.
12947088 2003 Silencing of CDX2 expression in colon cancer via a dominant repression pathway.
12559945 2003 Homeodomain protein CDX2 regulates goblet-specific MUC2 gene expression.
12518221 2003 Preparation of an anti-Cdx-2 antibody for analysis of different species Cdx-2 binding to acat2 promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270138 2002 The homeobox gene Cdx1 belongs to the p53-p21(WAF)-Bcl-2 network in intestinal epithelial cells.
12117877 2002 Expression of CDX2 in normal and neoplastic human colon tissue and during differentiation of an in vitro model system.
11871772 2002 Expression of homeobox gene CDX2 precedes that of CDX1 during the progression of intestinal metaplasia.
11846061 2001 Expression of Cdx1 and Cdx2 mRNAs and relevance of this expression to differentiation in human gastrointestinal mucosa--with special emphasis on participation in intestinal metaplasia of the human stomach.
11729123 2001 Phosphorylation of the serine 60 residue within the Cdx2 activation domain mediates its transactivation capacity.
11161380 2001 The homeobox gene CDX2 in colorectal carcinoma: a genetic analysis.
10677375 2000 Interaction between the homeodomain proteins Cdx2 and HNF1alpha mediates expression of the lactase-phlorizin hydrolase gene.
10506141 1999 Glucagon gene transcription activation mediated by synergistic interactions of pax-6 and cdx-2 with the p300 co-activator.
9933478 1999 The caudal-related homeodomain protein Cdx-2 regulates vitamin D receptor gene expression in the small intestine.
9459001 1997 Cloning and chromosome assignment of the human CDX2 gene.
9247466 1997 Differences in expression of homeobox transcription factors in proximal and distal human small intestine.
9052785 1997 Homeosis and intestinal tumours in Cdx2 mutant mice.
9036867 1997 Molecular cloning, sequencing and expression of the mRNA encoding human Cdx1 and Cdx2 homeobox. Down-regulation of Cdx1 and Cdx2 mRNA expression during colorectal carcinogenesis.
8635654 1996 Isolation, characterization, and chromosomal mapping of the human insulin promoter factor 1 (IPF-1) gene.
8105782 1993 Identification of homeobox genes expressed in human T-lymphocytes.
7935448 1994 A homeodomain protein related to caudal regulates intestine-specific gene transcription.
7698771 1994 Localization of the genes encoding two transcription factors, LMX1 and CDX3, regulating insulin gene expression to human chromosomes 1 and 13.