Property Summary

NCBI Gene PubMed Count 40
PubMed Score 92.38
PubTator Score 66.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 6.4e-07
psoriasis 6685 1.9e-02
Disease Target Count Z-score Confidence
Cancer 2346 3.624 1.8
Bile reflux 8 3.517 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 1.9e-02
osteosarcoma 1.955 6.4e-07

Gene RIF (32)

PMID Text
26841784 Changes in CDX1/CDX2 mRNA expression in gastric mucosa following H. pylori eradication showed only insignificant results
26537799 Data indicate an association between highly fucosylated glycans and caudal type homeobox 1 (CDX1) and/or villin mRNA expression that both correlate with cell differentiation.
25775580 miR-215 is a link between CDX1 expression and BMI1 repression that governs differentiation in colorectal cancer
24836459 CDX1 restricts the invasion of HTR-8/SVneo trophoblast cells by inhibiting MMP-9 expression independently of the PI3K/AKT pathway.
23918153 Certain SNPs of Cdx1 and Cdx2 and their interactions with other risk factors are associated with Barrett's esophagus (BE) and may contribute to human susceptibility to BE.
23624503 Data indicate that autophagy is activated though the Cdx1-Bcl-2-LC3 pathway.
23618814 Oxidative stress regulates CDX1 expression in T84 colorectal cancer cells.
23613102 The differential regulation of the gene expression of CDX1, CDX2 and SOX2 in patients with gastric cancer affects not only the tumour but also the non-neoplastic tumour-distant mucosa.
23353818 Results showed an anti-growth effect of CDX1 and identified its miRNA regulatory mechanism in gastric cancer.
23329892 The findings represented the relation between CDX1 mutations and CDX1 genotype. Furthermore, it was suggested that the downregulation of CDX1 might be related to the development of Anorectal malformations .
23185413 analysis of an IRF2BP2-CDX1 fusion gene brought about by translocation t(1;5)(q42;q32) in mesenchymal chondrosarcoma
23127929 The homeotic transcription factor CDX1 is expressed in the intestinal epithelium at all stages of development. Review.
23112162 SALL4 and KLF5 were aberrantly expressed in the CDX1(+) intestinal metaplasia of the stomach. Sustained expression of CDX1 gave rise to the induction of early intestinal-stemness markers, followed by the expression of intestinal-differentiation markers.
22749770 The epigenetic inactivation of CDX1 by promoter methylation, as well as the functional link of CDX1 promoter methylation to the inflammatory NF-kappaB signaling pathway, were investigated.
22016432 The human ASBT promoter was activated transcriptionally by CDX1 and CDX2.
21532856 CDX1 and CDX2 in cancer group was significantly higher than control group
21518475 Expression of CDX1 and CDX4 is not correlated with the pathogenesis and relapse of adult ALL.
19781065 RNA interference of CDX1 and CDX2 and chromatin immunoprecipitation in colon cancer cells revealed that MS4A12 transcript and protein expression is essentially dependent on the presence of endogenous CDX2.
19468668 Our data suggested an important role of CDX1 and CDX2 in the development of Barrett's esophagus
19188603 KRT20 is directly regulated by CDX1, suggesting a role for CDX1 in maintaining differentiation in intestinal epithelial cells
19059241 CDX1 enhanced the expression of PPARgamma gene, a master transcriptional regulator of intestinal differentiation, at the transcriptional level, via functional interaction with CCAAT/enhancer-binding protein alpha (C/EBPalpha).
18953412 The ability of Cdx1 and c-myc to initiate the earliest stages of transdifferentiation of esophageal keratinocytes toward a cell fate characteristic of Barrett's esophagus.
18231635 Cdx1 is not an oncogene in normal intestinal epithelium.
18187048 changes in CDX2 and CDX1 expression determined by methyl group deprivation may constitute one of the mechanisms sustaining the protective role attributed to folate in colon cancer
15894614 Demethylation of the CDX1 promoter may be the key to the induction and maintenance of its expression and so of the Barrett's metaplasia phenotype.
15774940 Cdx1 activates the IAP gene via a novel cis element, whereas Cdx2 inhibits the Cdx1 effects
15215241 Cdx1 and Cdx2 inhibit colon cancer cell proliferation by blocking beta-catenin/TCF transcriptional activity
14715525 Upstream sequences contain regulatory elements directing transgene expression specifically to intestinal epithelium. Two active chromatin regions in CDX1 gene may function as potential intestine-specific enhancers.
14704280 absence of CDX1 mRNA expression in 7 of 37 CRC cell lines and shown that all 7 cell lines have a methylated CDX1 promoter
12970739 these data show that Cdx1 exhibits a complex pattern during colorectal cancer progression, a high level of expression in polyps, and in one-third of the specimens, suggest that this gene may be a factor in the process toward malignant transformation
12124393 CDX1 is downregulated after promoter methylation in colorectal tumor cell lines
11846061 Increased CDX1 mRNA expression is associated with chronic atrophic gastritis

AA Sequence

MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKD      1 - 70
DWAAAYGPGPAAPAASPASLAFGPPPDFSPVPAPPGPGPGLLAQPLGGPGTPSSPGAQRPTPYEWMRRSV     71 - 140
AAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKER    141 - 210
KVNKKKQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP                   211 - 265
//

Text Mined References (40)

PMID Year Title
26841784 2016 Follow-Up Study on CDX1 and CDX2 mRNA Expression in Noncancerous Gastric Mucosae After Helicobacter pylori Eradication.
26537799 2016 N-glycosylation Profiling of Colorectal Cancer Cell Lines Reveals Association of Fucosylation with Differentiation and Caudal Type Homebox 1 (CDX1)/Villin mRNA Expression.
26412852 2015 Comprehensive comparative homeobox gene annotation in human and mouse.
25775580 2015 The CDX1-microRNA-215 axis regulates colorectal cancer stem cell differentiation.
24836459 2014 CDX1 restricts the invasion of HTR-8/SVneo trophoblast cells by inhibiting MMP-9 expression.
24623306 2014 A KRAS-directed transcriptional silencing pathway that mediates the CpG island methylator phenotype.
23918153 2014 Single nucleotide polymorphisms of caudal type homeobox 1 and 2 are associated with Barrett's esophagus.
23624503 2013 Autophagy of cancer stem cells is involved with chemoresistance of colon cancer cells.
23618814 2013 Oxidative stress causes epigenetic alteration of CDX1 expression in colorectal cancer cells.
23613102 2013 Dysregulation of CDX1, CDX2 and SOX2 in patients with gastric cancer also affects the non-malignant mucosa.
23353818 2014 MicroRNA-296-5p increases proliferation in gastric cancer through repression of Caudal-related homeobox 1.
23329892 2013 Mutations and down-regulation of CDX1 in children with anorectal malformations.
23185413 2012 Whole-transcriptome sequencing identifies novel IRF2BP2-CDX1 fusion gene brought about by translocation t(1;5)(q42;q32) in mesenchymal chondrosarcoma.
23127929 2012 [Identity and intestinal pathologies: the Cdx2 homeotic gene].
23112162 2012 CDX1 confers intestinal phenotype on gastric epithelial cells via induction of stemness-associated reprogramming factors SALL4 and KLF5.
22749770 2012 Methylation-dependent activation of CDX1 through NF-?B: a link from inflammation to intestinal metaplasia in the human stomach.
22016432 2012 Regulation of the gene encoding the intestinal bile acid transporter ASBT by the caudal-type homeobox proteins CDX1 and CDX2.
21532856 2011 CDX1 and CDX2 expression in intestinal metaplasia, dysplasia and gastric cancer.
21518475 2011 [Expression and clinical significance of caudal type homeobox transcription factor-2 in adult acute lymphocytic leukemia].
19781065 2009 Selective activation of tumor growth-promoting Ca2+ channel MS4A12 in colon cancer by caudal type homeobox transcription factor CDX2.
19468668 2009 Differential gene expression in normal esophagus and Barrett's esophagus.
19188603 2009 Gastrointestinal differentiation marker Cytokeratin 20 is regulated by homeobox gene CDX1.
19059241 2009 Homeodomain transcription factor CDX1 is required for the transcriptional induction of PPARgamma in intestinal cell differentiation.
18953412 2008 Cdx1 and c-Myc foster the initiation of transdifferentiation of the normal esophageal squamous epithelium toward Barrett's esophagus.
18231635 2008 The homeodomain transcription factor Cdx1 does not behave as an oncogene in normal mouse intestine.
18187048 2008 Differential regulation of CDX1 and CDX2 gene expression by deficiency in methyl group donors.
15894614 2005 CDX1 is an important molecular mediator of Barrett's metaplasia.
15774940 2005 Differential regulation of intestinal alkaline phosphatase gene expression by Cdx1 and Cdx2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15215241 2004 Cdx1 inhibits human colon cancer cell proliferation by reducing beta-catenin/T-cell factor transcriptional activity.
15143193 2004 Cdx1 autoregulation is governed by a novel Cdx1-LEF1 transcription complex.
14715525 2004 Putative intestine-specific enhancers located in 5' sequence of the CDX1 gene regulate CDX1 expression in the intestine.
14704280 2004 Loss of CDX1 expression in colorectal carcinoma: promoter methylation, mutation, and loss of heterozygosity analyses of 37 cell lines.
12970739 2003 Cdx1 homeobox gene during human colon cancer progression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12124393 2002 DNA methylation down-regulates CDX1 gene expression in colorectal cancer cell lines.
11846061 2001 Expression of Cdx1 and Cdx2 mRNAs and relevance of this expression to differentiation in human gastrointestinal mucosa--with special emphasis on participation in intestinal metaplasia of the human stomach.
9036867 1997 Molecular cloning, sequencing and expression of the mRNA encoding human Cdx1 and Cdx2 homeobox. Down-regulation of Cdx1 and Cdx2 mRNA expression during colorectal carcinogenesis.
8563749 1996 Positional cloning of a gene involved in the pathogenesis of Treacher Collins syndrome. The Treacher Collins Syndrome Collaborative Group.
8530027 1995 Isolation, characterization, and precise physical localization of human CDX1, a caudal-type homeobox gene.