Property Summary

NCBI Gene PubMed Count 14
PubMed Score 26.84
PubTator Score 27.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
gastric cancer -1.500 1.9e-02
pancreatic cancer -1.300 3.7e-02
oligodendroglioma 1.100 1.5e-02
psoriasis 1.200 1.2e-03
osteosarcoma -1.129 4.3e-04
ependymoma 1.200 1.1e-04
medulloblastoma 1.800 6.6e-03
glioblastoma 2.100 2.0e-03
atypical teratoid / rhabdoid tumor 2.200 2.2e-04
medulloblastoma, large-cell 2.800 3.0e-05
acute quadriplegic myopathy 1.082 1.6e-04
tuberculosis and treatment for 6 months 1.200 3.2e-04
pediatric high grade glioma 1.500 6.7e-03
non primary Sjogren syndrome sicca 1.400 2.6e-02
pancreatic carcinoma -1.300 3.7e-02
lung adenocarcinoma -1.200 1.0e-08
Polycystic Ovary Syndrome -1.027 2.8e-02
ovarian cancer -1.700 6.7e-06
Gaucher disease type 1 -1.500 4.6e-02
dermatomyositis -1.300 3.0e-04

Synonym

Accession Q9UKY7 B3KUC2 Q96IP9
Symbols H41

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
25631074 Cellular biotinylated CDV3 mouse homolog protein is incorporated into HIV-1 Gag virus-like particles
12359334 Differential mRNA display shows increased levels of CDV3 in mice with cardiac hypertrophy.

AA Sequence

MAETEERSLDNFFAKRDKKKKKERSNRAASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAG      1 - 70
PGAATKAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDPGDNWEEGGGGGGGMEKSSGP     71 - 140
WNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRKD    141 - 210
KEMEKSFEVVRHKNRGRDEVSKNQALKLQLDNQYAVLENQKSSHSQYN                          211 - 258
//

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23568457 2013 Genetic variants associated with disordered eating.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21811255 2011 A two-phase case-control study for colorectal cancer genetic susceptibility: candidate genes from chromosomal regions 9q22 and 3q22.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359334 2002 Novel mRNA molecules are induced in hypertrophied ventricles of carnitine-deficient mice and belong to a family of up-regulated gene in cells overexpressing c-erbB-2.
10497265 1999 Identification of differentially expressed genes associated with HER-2/neu overexpression in human breast cancer cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.