Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.33
PubTator Score 21.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.039 1.2e-02
psoriasis -1.900 5.5e-04
osteosarcoma -2.061 5.0e-06
ependymoma -1.100 6.9e-08
glioblastoma -1.600 1.0e-04
medulloblastoma -1.500 2.1e-07
atypical teratoid / rhabdoid tumor -1.900 2.7e-09
medulloblastoma, large-cell -1.900 3.2e-07
primitive neuroectodermal tumor -1.100 1.8e-04
pancreatic ductal adenocarcinoma liver m... -1.117 1.6e-02
intraductal papillary-mucinous neoplasm ... 1.600 3.0e-02
adult high grade glioma -1.400 6.8e-05
pilocytic astrocytoma -1.100 2.3e-05
subependymal giant cell astrocytoma -1.205 2.4e-02
invasive ductal carcinoma -1.300 3.5e-03
ovarian cancer -1.700 9.9e-11

 IMPC Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (4)

PMID Text
25375833 distinct properties of the two isoforms of CDP-diacylglycerol synthase
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWKNWW      1 - 70
VRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFF     71 - 140
YGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQ    141 - 210
SHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYV    211 - 280
MSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIG    281 - 350
PFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQ    351 - 420
QLHIFNTLRSHLIDKGMLTSTTEDE                                                 421 - 445
//

Text Mined References (24)

PMID Year Title
25375833 2014 Distinct properties of the two isoforms of CDP-diacylglycerol synthase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18088087 2008 Phosphoproteome of resting human platelets.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12457874 2002 Genomic organization of human CDS2 and evaluation as a candidate gene for corneal hereditary endothelial dystrophy 2 on chromosome 20p13.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9889000 1999 Identification and characterization of CDS2, a mammalian homolog of the Drosophila CDP-diacylglycerol synthase gene.
9806839 1998 Isolation and chromosomal localization of two human CDP-diacylglycerol synthase (CDS) genes.
9407135 1997 The role of CDP-diacylglycerol synthetase and phosphatidylinositol synthase activity levels in the regulation of cellular phosphatidylinositol content.