Property Summary

NCBI Gene PubMed Count 3
PubMed Score 9.41
PubTator Score 3.17

Knowledge Summary

Patent

No data available

Expression

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MRRAAGMEDFSAEEEESWYDQQDLEQDLHLAAELGKTLLERNKELEGSLQQMYSTNEEQVQEIEYLTKQL      1 - 70
DTLRHVNEQHAKVYEQLDLTARDLELTNHRLVLESKAAQQKIHGLTETIERLQAQVEELQAQVEQLRGLE     71 - 140
QLRVLREKRERRRTIHTFPCLKELCTSPRCKDAFRLHSSSLELGPRPLEQENERLQTLVGALRSQVSQER    141 - 210
QRKERAEREYTAVLQEYSELERQLCEMEACRLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLT    211 - 280
QAPEADDPQPGRGDDLGAQDGVSSPAASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGM    281 - 350
SILREVDEQYHALLEKYEELLSKCRQHGAGVRHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQ    351 - 420
HVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSSK                             421 - 465
//

Text Mined References (7)

PMID Year Title