Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.8e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.176 3.8e-05

 Compartment GO Term (2)

AA Sequence

MASHVECRPLGVFECELCTLTAPYSYVGQKPPNTQSMVLLEESYVMKDPFTSDKDRFLVLGSCCSLCSRL      1 - 70
VCVGPECSLFYSKRFCLPCVRENINAFPQEIRQDLEKRKAPSKRTPSQPGSRT                      71 - 123
//

Text Mined References (5)

PMID Year Title