Property Summary

NCBI Gene PubMed Count 29
PubMed Score 31.38
PubTator Score 172.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Protein-protein Interaction (7)

Gene RIF (16)

PMID Text
26785325 methylation of the CDO1 gene promoter could be strong prognostic indicator in primary BC without preoperative treatment.
25904753 CDO1 promoter methylation may not substitute common prognostic makers to predict ccRCC survival, but offers additional, relevant prognostic information, indicating that it might be a novel molecular marker to determine ccRCC prognosis
25903467 Decreased expression of CDO1 is associated with esophageal squamous cell carcinoma.
25261132 A structural role of the Cys-Tyr cofactor coordinates the ferrous iron in the active site of CDO1.
24948044 A high negative correlation between promoter DNA methylation and gene expression was observed for CDO1, ZNF331 and ZSCAN18 in gastrointestinal tumors.
24646840 methylation status of serum CDO1 gene promoter may be helpful in the diagnosis of hepatocellular carcinoma (HCC) and the estimation of the HCC stages.
24553827 TGF-b1 suppressed Cdo1 gene transcription through the MEK/ERK pathway.
24486589 we define a three-gene panel, CDO1, HOXA9, and TAC1, which we subsequently validate in two independent cohorts of primary NSCLC samples
23630167 Our study shows the importance of CDO1 inactivation in breast cancer and its clinical potential as a biomarker and therapeutic target to overcome resistance to anthracyclines.
23028699 CDO1 as a novel tumor suppressor gene and a potentially valuable molecular marker for human cancer
22011669 We confirmed that the expression of CDO1 in squamous cell carcinoma is regulated by DNA methylation of its specific promoter region.
20515469 DNA methylation of CDO1 predicted distant recurrence in lymph node-positive patients with estrogen receptor-positive tumors treated with adjuvant anthracycline containing therapy.
19199799 Cysteine dioxygenase contains a 3His ligand motif rather than 2His/1Asp. The former is essential for optimal dioxygenation activity. Mutants with a 2His/1Asp motif may give sulfoxides as byproduct due to incomplete dioxygenation.
18976975 Knockdown of cysteine dioxygenase, type I (CDO1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18033314 Upon comparison of PBMC and skin samples of Sezary syndrome versus mycosis fungoides, CDO1 and DNM3 were found upregulated only in Sezary syndrome.
17327371 CDO is capable of altering intracellular cysteine levels as well as glutathione levels.

AA Sequence

MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKF      1 - 70
NLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLH     71 - 140
RVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN              141 - 200
//

Text Mined References (34)

PMID Year Title
26785325 2016 Prognostic Significance of Promoter DNA Hypermethylation of cysteine dioxygenase 1 (CDO1) Gene in Primary Breast Cancer.
25904753 2015 Promoter Methylation of CDO1 Identifies Clear-Cell Renal Cell Cancer Patients with Poor Survival Outcome.
25903467 2015 Epigenetic regulation of the novel tumor suppressor cysteine dioxygenase 1 in esophageal squamous cell carcinoma.
25411281 2014 Meta-analysis of genome-wide association studies for circulating phylloquinone concentrations.
25261132 2015 Involvement of the Cys-Tyr cofactor on iron binding in the active site of human cysteine dioxygenase.
24948044 2015 The novel colorectal cancer biomarkers CDO1, ZSCAN18 and ZNF331 are frequently methylated across gastrointestinal cancers.
24646840 2014 Methylated cysteine dioxygenase-1 gene promoter in the serum is a potential biomarker for hepatitis B virus-related hepatocellular carcinoma.
24553827 2014 Branched-chain amino acids inhibit the TGF-beta-induced down-regulation of taurine biosynthetic enzyme cysteine dioxygenase in HepG2 cells.
24486589 2014 Functional identification of cancer-specific methylation of CDO1, HOXA9, and TAC1 for the diagnosis of lung cancer.
23630167 2013 Frequent inactivation of cysteine dioxygenase type 1 contributes to survival of breast cancer cells and resistance to anthracyclines.
23028699 2012 Cysteine dioxygenase 1 is a tumor suppressor gene silenced by promoter methylation in multiple human cancers.
22011669 2012 Genome-wide analysis of DNA methylation and the gene expression change in lung cancer.
21269460 2011 Initial characterization of the human central proteome.
20515469 2010 CDO1 promoter methylation is a biomarker for outcome prediction of anthracycline treated, estrogen receptor-positive, lymph node-positive breast cancer patients.
19199799 2009 Why do cysteine dioxygenase enzymes contain a 3-His ligand motif rather than a 2His/1Asp motif like most nonheme dioxygenases?
18033314 2008 Sézary syndrome is a unique cutaneous T-cell lymphoma as identified by an expanded gene signature including diagnostic marker molecules CDO1 and DNM3.
17327371 2007 Overexpression of cysteine dioxygenase reduces intracellular cysteine and glutathione pools in HepG2/C3A cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17135237 2007 An insight into the mechanism of human cysteine dioxygenase. Key roles of the thioether-bonded tyrosine-cysteine cofactor.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12871209 2003 Functional characterization and regulation of the taurine transporter and cysteine dioxygenase in human hepatoblastoma HepG2 cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12110289 2002 Cysteine dioxygenase: modulation of expression in human cell lines by cytokines and control of sulphate production.
11597177 2001 Identification and initial characterization of 5000 expressed sequenced tags (ESTs) each from adult human normal and osteoarthritic cartilage cDNA libraries.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11101006 2000 Development of an in vitro model for cysteine dioxygenase expression in the brain.
10427686 1999 Human cysteine dioxygenase gene: structural organization, tissue-specific expression and downregulation by phorbol 12-myristate 13-acetate.
9497919 1997 Human cysteine dioxygenase type I (CDO-I; EC 1.13.11.20): 5' flanking region and intron-exon structure of the gene.
8835096 1996 Chromosomal localisation of genes coding for human and mouse liver cytosolic cysteine dioxygenase.
7524679 1994 Human cysteine dioxygenase type I: primary structure derived from base sequencing of cDNA.