Property Summary

NCBI Gene PubMed Count 40
PubMed Score 39.41
PubTator Score 433.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
malignant mesothelioma 1.200 3.0e-06
astrocytic glioma -1.300 9.2e-03
ependymoma -1.200 3.5e-02
oligodendroglioma -1.400 5.6e-03
glioblastoma 2.200 6.1e-05
group 3 medulloblastoma 3.200 3.1e-07
atypical teratoid / rhabdoid tumor 2.100 1.3e-06
medulloblastoma, large-cell 2.800 5.0e-07
primitive neuroectodermal tumor 1.900 1.1e-03
Atopic dermatitis 1.400 1.3e-03
adrenocortical carcinoma 3.638 7.6e-08
non-small cell lung cancer 3.311 1.4e-30
intraductal papillary-mucinous carcinoma... 2.400 1.6e-04
intraductal papillary-mucinous neoplasm ... 3.200 8.1e-04
lung cancer 4.500 2.1e-07
pancreatic cancer 1.200 1.8e-03
interstitial cystitis 2.900 8.4e-06
lung adenocarcinoma 1.400 3.0e-07
pediatric high grade glioma 2.000 6.2e-06
acute myeloid leukemia -1.800 2.8e-02
psoriasis 2.100 3.4e-12
Endometriosis 1.911 1.5e-02
breast carcinoma 1.600 1.8e-40
Breast cancer 2.500 4.5e-14
ductal carcinoma in situ 2.700 2.2e-04
invasive ductal carcinoma 3.300 4.3e-05
ulcerative colitis 1.100 3.2e-04
ovarian cancer 1.800 1.6e-04

Gene RIF (22)

PMID Text
26586430 Knockdown of Cdkn3 stabilizes Mps1 at centrosomes.
26554648 CDKN3 overexpression in lung adenocarcinoma is not attributed to alternative splicing or mutation but is likely due to increased mitotic activity, arguing against CDKN3 as a tumour suppressor
26372210 CDKN3 mRNA may be a good survival biomarker and potential therapeutic target in cervical cancer
26191143 CDKN3 knockdown reduces cell proliferation, invasion and promotes apoptosis in human ovarian cancer cells.
25735390 High CDKN3 expression is associated with colorectal cancer.
25360622 These results highlight the importance of CDKN3 in Bcr-Abl-mediated leukemogenesis.
24704824 these data identify KAP as a major regulator of cell division via interactions with numerous target proteins. aberrant splicing or miR-26a decreases KAP expression to promote glioblastoma growth and invasion.
24573179 CDKN3 may play an important role in the development and proliferation of epithelial ovarian cancer
23775190 CDKN3 controls mitosis through the CDC2 signaling axis.
23555623 RelB activation is key for promoting multiple myeloma cell survival through the upregulation of anti-apoptotic proteins, in particular, CIAP2.
23405241 High CDKN3 expression is associated with cervical cancer.
23292002 KAP is overexpressed in alcohol-related hepatocellular carcinoma.
22390936 These results suggest that CDKN3 acts as an oncogene in human hepatocellular carcinoma and antagonism of CDKN3 may be of interest for the treatment of HCC.
21535270 analysis of CDKN3 cell cycle networks and the molecular mechanism of non-malignancy associated hepatitis/cirrhosis and HCC transformation
21396835 cyclin-dependent kinase-associated protein phosphatase expression was associated with poorly differentiated Renal cell carcinoma
20677014 Observational study of gene-disease association. (HuGE Navigator)
19728335 IKKalpha, IKKbeta, RANK, Maspin, c-FLIP, Cip2 and cyclinD1 were found to show significant differences between hepatocellular tumor tissue and its corresponding adjacent tissue.
17056014 the reduction of KAP1 levels promotes p53-dependent p21 induction and inhibits cell proliferation in actinomycin D-treated cells.
16945326 Pax3 represses transcription through a novel mechanism involving competition between corepressor KAP1 and the heterochromatin-binding protein HP1gamma
15671017 HTm4 binding to KAP.Cdk2.cyclin A complex enhances the phosphatase activity of KAP, dissociates cyclin A, and facilitates KAP dephosphorylation of Cdk2
15147518 In choline-deficient neuroblastoma cells, the promoter of the cyclin-dependent kinase inhibitor 3 gene (CDKN3) was hypomethylated. This was associated with increased expression of CDKN3 gene product kinase-associated phosphatase (KAP)
12745075 Identification of a KAP domain that interacts with cyclin-dependent kinase 2.

AA Sequence

MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNVQKDTEELKSC      1 - 70
GIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHC     71 - 140
YGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSV    141 - 210
SR                                                                        211 - 212
//

Text Mined References (41)

PMID Year Title
26586430 2015 The Tumor Suppressor Cdkn3 Is Required for Maintaining the Proper Number of Centrosomes by Regulating the Centrosomal Stability of Mps1.
26554648 2015 Overexpression of major CDKN3 transcripts is associated with poor survival in lung adenocarcinoma.
26372210 2015 CDKN3 mRNA as a Biomarker for Survival and Therapeutic Target in Cervical Cancer.
26191143 2015 CDKN3 knockdown reduces cell proliferation, invasion and promotes apoptosis in human ovarian cancer.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25735390 2015 Mechanistic studies of cyclin-dependent kinase inhibitor 3 (CDKN3) in colorectal cancer.
25360622 2014 A critical role of CDKN3 in Bcr-Abl-mediated tumorigenesis.
24704824 2015 KAP regulates ROCK2 and Cdk2 in an RNA-activated glioblastoma invasion pathway.
24573179 2014 CDKN3 is an independent prognostic factor and promotes ovarian carcinoma cell proliferation in ovarian cancer.
24218572 2013 CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23775190 2013 The tumor suppressor CDKN3 controls mitosis.
23555623 2013 Frequent engagement of RelB activation is critical for cell survival in multiple myeloma.
23405241 2013 Mitosis is a source of potential markers for screening and survival and therapeutic targets in cervical cancer.
23292002 2013 Cyclin-dependent kinase-associated protein phosphatase is overexpressed in alcohol-related hepatocellular carcinoma and influences xenograft tumor growth.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
22390936 2012 Cyclin-dependent kinase inhibitor 3 is overexpressed in hepatocellular carcinoma and promotes tumor cell proliferation.
21535270 2011 Cyclin-dependent kinase inhibitor 3 (CDKN3) novel cell cycle computational network between human non-malignancy associated hepatitis/cirrhosis and hepatocellular carcinoma (HCC) transformation.
21396835 Overexpression of cyclin-dependent kinase-associated protein phosphatase enhances cell proliferation in renal cancer cells.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19728335 2010 High expression levels of IKKalpha and IKKbeta are necessary for the malignant properties of liver cancer.
17056014 2006 KAP1 dictates p53 response induced by chemotherapeutic agents via Mdm2 interaction.
16945326 2006 Transcriptional repression activity of PAX3 is modulated by competition between corepressor KAP1 and heterochromatin protein 1.
15671017 2005 Binding of HTm4 to cyclin-dependent kinase (Cdk)-associated phosphatase (KAP).Cdk2.cyclin A complex enhances the phosphatase activity of KAP, dissociates cyclin A, and facilitates KAP dephosphorylation of Cdk2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15147518 2004 Choline availability modulates human neuroblastoma cell proliferation and alters the methylation of the promoter region of the cyclin-dependent kinase inhibitor 3 gene.
12745075 2003 Abolishment of the interaction between cyclin-dependent kinase 2 and Cdk-associated protein phosphatase by a truncated KAP mutant.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11781350 2002 Human HTm4 is a hematopoietic cell cycle regulator.
11684017 2001 C/EBPalpha arrests cell proliferation through direct inhibition of Cdk2 and Cdk4.
11463386 2001 Phosphoprotein-protein interactions revealed by the crystal structure of kinase-associated phosphatase in complex with phosphoCDK2.
10987270 2000 Aberrant transcripts of the cyclin-dependent kinase-associated protein phosphatase in hepatocellular carcinoma.
10669749 2000 Overexpression of kinase-associated phosphatase (KAP) in breast and prostate cancer and inhibition of the transformed phenotype by antisense KAP expression.
9989807 1999 A rate limiting function of cdc25A for S phase entry inversely correlates with tyrosine dephosphorylation of Cdk2.
9840943 1998 Cyclin E2, a novel human G1 cyclin and activating partner of CDK2 and CDK3, is induced by viral oncoproteins.
8242751 1993 The p21 Cdk-interacting protein Cip1 is a potent inhibitor of G1 cyclin-dependent kinases.
8242750 1993 Cdi1, a human G1 and S phase protein phosphatase that associates with Cdk2.
8127873 1994 KAP: a dual specificity phosphatase that interacts with cyclin-dependent kinases.
7698009 1995 Chromosomal mapping of the genes for the human cell cycle proteins cyclin C (CCNC), cyclin E (CCNE), p21 (CDKN1) and KAP (CDKN3).
7569954 1995 Dephosphorylation of Cdk2 Thr160 by the cyclin-dependent kinase-interacting phosphatase KAP in the absence of cyclin.