Property Summary

NCBI Gene PubMed Count 66
PubMed Score 109.01
PubTator Score 89.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis 1.600 2.1e-04
astrocytoma 1.200 5.9e-06
glioblastoma 2.500 3.5e-09
oligodendroglioma 1.200 9.5e-05
osteosarcoma 1.664 1.3e-04
ependymoma 1.300 2.0e-03
sonic hedgehog group medulloblastoma 2.400 3.1e-06
intraductal papillary-mucinous adenoma (... -1.300 7.6e-04
breast carcinoma -1.700 1.0e-03
fibroadenoma -2.100 2.9e-02
adult high grade glioma 2.800 2.1e-05
pilocytic astrocytoma 2.500 5.0e-08
ductal carcinoma in situ -2.300 2.6e-04
invasive ductal carcinoma -2.800 3.6e-04
ovarian cancer -1.200 4.9e-02
Breast cancer 1.700 9.5e-06
pituitary cancer -1.100 2.3e-04

Synonym

Accession P42773 Q8TB83
Symbols p18
INK4C
p18-INK4C

Gene

PDB

1BU9   1G3N   1IHB   1MX2   1MX4   1MX6  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (42)

PMID Text
26740620 Data suggest that cell cycle-dependent kinase inhibitors CDKN2C/p18 and CDKN1A/p21 facilitate cell cycle entry/cell proliferation of quiescent adult human pancreatic beta cells in primary culture (from tissues obtained from organ donors).
26350239 DNA methyltransferase 3A promotes cell proliferation by silencing CDK inhibitor p18INK4C in gastric carcinogenesis
24127162 Mutations in CDKN2C is associated with sporadic parathyroid adenoma.
23896637 this studydemonstrated abundant levels of the critical negative cell-cycle regulators, p27(Kip1), its phosphorylated form, p-p27(S10), p18Ink4c, and GSK-3, in beta-cells of both adult human and mouse pancreatic islets, which contribute to maintenance of beta-cell quiescence.
23715670 in 85 sporadic parathyroid adenomas, study identified alterations in 5 adenomas: 2 contained heterozygous changes in CDKN1A, 1 germline and 1 of undetermined germline status; 1 had a CDKN2B germline alteration, accompanied by loss of the normal allele in the tumor (LOH); 2 had variants of CDKN2C, 1 somatic and 1 germline with LOH
22896639 Analysis of B1a lymphocyte phenotypes of p18-deficient C57BL/6 mice finds that p18 is a key regulator of the size of the B1a cell pool.
22685290 up-regulated HULC promotes proliferation of hepatoma cells through suppressing p18
22080569 propose that the contrasting behavior of the two very similar INK4 proteins could reflect their respective roles in senescence versus differentiation
21994415 Data indicate that the role of CDKN2C in the adverse outcome of cases with hemizygous deletion was less certain.
21112821 results demonstrate for the first time that N-Myc is a downstream target of RET2A signaling, and propose that induction of N-Myc by RET2A is a key step leading to lower p18 levels during MEN2A tumorigenesis
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20833334 review presents the recent advances in MEN-4 and other multiple endocrine neoplasias and summarises the current knowledge of how P27KIP1 and p18-INK4C may be implicated in endocrine neoplasia [review]
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20507346 Observational study of gene-disease association. (HuGE Navigator)
19738611 Observational study of gene-disease association. (HuGE Navigator)
19509251 Results identified a molecular basis for CDK inhibitors to exert an antitumor effect in p18-deficient cancers and support the clinical use of CDK inhibitors.
19411068 p18(INK4C) is a downstream target of GATA3, constrains luminal progenitor cell expansion, and suppresses luminal tumorigenesis in the mammary gland
19401813 The down-regulation of p18(INK4C) expression may contribute to the tumorigenesis of pituitary adenomas.
19258477 Observational study of gene-disease association. (HuGE Navigator)
19141585 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
18973139 Purpose was to investigate genetic alterations of CDKN2C gene in 38 pituitary adenomas. The absence of CDKN2C protein was correlated with LOH of the CDKN2C locus on chromosome 1 and with methylation of the CDKN2C promoter.
18942719 P18 is a tumor suppressor gene involved in human medullary thyroid carcinoma and pheochromocytoma
18829482 deletions of CDKN2C are important in the progression and clinical outcome of myeloma
18829482 Observational study of gene-disease association. (HuGE Navigator)
18642058 NaBu-mediated p18( INK4C ) regulation played a role in cell cycle arrest and erythroid differentiation in K562 cells.
18507837 Observational study of gene-disease association. (HuGE Navigator)
18394558 These findings uncover a feedback regulatory circuit in the astrocytic lineage and demonstrate tumor suppressor role for p18(INK4C) in human glioblastoma wherein it functions cooperatively with other INK4 family.
18316595 oncogenic RET and loss of p18 cooperate in the multistep tumorigenesis of medullary thyroid carcinoma
18281541 Observational study of gene-disease association. (HuGE Navigator)
18174243 Observational study of gene-disease association. (HuGE Navigator)
17803708 Expression of p15, p18 and p27 was not generally related to the MEN1 gene mutational status of the investigated 18 pancreatic endocrine tumours.
17710155 data suggest that p27 and p18 are unlikely to present classic tumor-suppressor genes in sporadic pancreatic endocrine tumors
17409409 Observational study of gene-disease association. (HuGE Navigator)
16802342 Transfer of the p16(INK4a) and p18(INK4c) genes and CDK4I suppressed the production of MMP-3 and MCP-1.
16260494 p18(INK4C) loss may contribute to medulloblastoma formation in children
15107819 protein kinase C promotes human cancer cell growth through downregulation of p18(INK4c)
14645011 p18INK4c may function as a tumor suppressor in Hodgkin lymphoma, and inactivation may contribute to cell cycle deregulation and defective terminal differentiation of the Reed-Sternberg cells.
12698196 Inhibitor shows antitumor effect on glioma cells.
12203782 Deletions in the CDKN2C locus and hypermethylation in the CDKN2C promoter region play a role in ovarian granulosa cell tumorogenesis.
12077144 conclude that E2F proteins and Sp1 play an important role in the control of p18 expression
11668523 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)

AA Sequence

MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTG      1 - 70
FAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTA     71 - 140
CDLARLYGRNEVVSLMQANGAGGATNLQ                                              141 - 168
//

Text Mined References (67)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26740620 2016 High-throughput Functional Genomics Identifies Regulators of Primary Human Beta Cell Proliferation.
26350239 2015 DNA methyltransferase 3A promotes cell proliferation by silencing CDK inhibitor p18INK4C in gastric carcinogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
24127162 2013 Mutations in CDKN2C (p18) and CDKN2D (p19) may cause sporadic parathyroid adenoma.
23896637 The negative cell cycle regulators, p27(Kip1), p18(Ink4c), and GSK-3, play critical role in maintaining quiescence of adult human pancreatic ?-cells and restrict their ability to proliferate.
23715670 2013 Germline and somatic mutations in cyclin-dependent kinase inhibitor genes CDKN1A, CDKN2B, and CDKN2C in sporadic parathyroid adenomas.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
22896639 2012 Cyclin-dependent kinase inhibitor Cdkn2c deficiency promotes B1a cell expansion and autoimmunity in a mouse model of lupus.
22685290 2012 Elevation of highly up-regulated in liver cancer (HULC) by hepatitis B virus X protein promotes hepatoma cell proliferation via down-regulating p18.
22080569 2012 Contrasting behavior of the p18INK4c and p16INK4a tumor suppressors in both replicative and oncogene-induced senescence.
21994415 2011 Mapping of chromosome 1p deletions in myeloma identifies FAM46C at 1p12 and CDKN2C at 1p32.3 as being genes in regions associated with adverse survival.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
21112821 2011 N-Myc is a downstream target of RET signaling and is required for transcriptional regulation of p18(Ink4c) by the transforming mutant RET(C634R).
21076409 2010 Common variants in 22 loci are associated with QRS duration and cardiac ventricular conduction.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20833334 2010 MEN-4 and other multiple endocrine neoplasias due to cyclin-dependent kinase inhibitors (p27(Kip1) and p18(INK4C)) mutations.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20507346 2010 The role of germline AIP, MEN1, PRKAR1A, CDKN1B and CDKN2C mutations in causing pituitary adenomas in a large cohort of children, adolescents, and patients with genetic syndromes.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19509251 2009 Expression levels of p18INK4C modify the cellular efficacy of cyclin-dependent kinase inhibitors via regulation of Mcl-1 expression in tumor cell lines.
19411068 2009 CDK inhibitor p18(INK4c) is a downstream target of GATA3 and restrains mammary luminal progenitor cell proliferation and tumorigenesis.
19401813 2009 Expression of p18(INK4C) is down-regulated in human pituitary adenomas.
19258477 2009 Candidate gene analysis using imputed genotypes: cell cycle single-nucleotide polymorphisms and ovarian cancer risk.
19141585 2009 Rare germline mutations in cyclin-dependent kinase inhibitor genes in multiple endocrine neoplasia type 1 and related states.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18973139 2009 Frequent loss of the CDKN2C (p18INK4c) gene product in pituitary adenomas.
18942719 2009 P18 is a tumor suppressor gene involved in human medullary thyroid carcinoma and pheochromocytoma development.
18829482 2008 Deletions of CDKN2C in multiple myeloma: biological and clinical implications.
18642058 2008 Sodium butyrate-induced upregulation of p18( INK4C ) gene affects K562 cell G (0)/G (1) arrest and differentiation.
18507837 2008 Effects of common germline genetic variation in cell cycle control genes on breast cancer survival: results from a population-based cohort.
18394558 2008 Feedback circuit among INK4 tumor suppressors constrains human glioblastoma development.
18316595 2008 Synergistic effect of oncogenic RET and loss of p18 on medullary thyroid carcinoma development.
18281541 2008 Effects of common germ-line genetic variation in cell cycle genes on ovarian cancer survival.
18174243 2008 Association of single-nucleotide polymorphisms in the cell cycle genes with breast cancer in the British population.
17803708 2008 Evaluation of CDKN2C/p18, CDKN1B/p27 and CDKN2B/p15 mRNA expression, and CpG methylation status in sporadic and MEN1-associated pancreatic endocrine tumours.
17710155 2007 Mutational analysis of p27 (CDKN1B) and p18 (CDKN2C) in sporadic pancreatic endocrine tumors argues against tumor-suppressor function.
17409409 2007 Tagging single nucleotide polymorphisms in cell cycle control genes and susceptibility to invasive epithelial ovarian cancer.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16802342 2006 Direct modulation of rheumatoid inflammatory mediator expression in retinoblastoma protein-dependent and -independent pathways by cyclin-dependent kinase 4/6.
16260494 2005 The tumor suppressors Ink4c and p53 collaborate independently with Patched to suppress medulloblastoma formation.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15107819 2004 Activation of protein kinase C promotes human cancer cell growth through downregulation of p18(INK4c).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645011 2004 Silencing of the p18INK4c gene by promoter hypermethylation in Reed-Sternberg cells in Hodgkin lymphomas.
12698196 2003 Antitumour effect of cyclin-dependent kinase inhibitors (p16(INK4A), p18(INK4C), p19(INK4D), p21(WAF1/CIP1) and p27(KIP1)) on malignant glioma cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12203782 2002 Evidence of a role for the INK4 family of cyclin-dependent kinase inhibitors in ovarian granulosa cell tumors.
12077144 2002 Regulation of the human cyclin-dependent kinase inhibitor p18INK4c by the transcription factors E2F1 and Sp1.
11800646 2002 Immunohistochemical analysis of p18INK4C and p14ARF protein expression in 117 oligodendrogliomas: correlation with tumor grade and clinical outcome.
11668523 2001 A single nucleotide polymorphism in the 3'untranslated region of the CDKN2A gene is common in sporadic primary melanomas but mutations in the CDKN2B, CDKN2C, CDK4 and p53 genes are rare.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10208428 1999 Comparison of the effectiveness of adenovirus vectors expressing cyclin kinase inhibitors p16INK4A, p18INK4C, p19INK4D, p21(WAF1/CIP1) and p27KIP1 in inducing cell cycle arrest, apoptosis and inhibition of tumorigenicity.
10074345 1999 Tumor suppressor INK4: determination of the solution structure of p18INK4C and demonstration of the functional significance of loops in p18INK4C and p16INK4A.
9973200 1999 Identification of functional elements of p18INK4C essential for binding and inhibition of cyclin-dependent kinase (CDK) 4 and CDK6.
9636670 1998 Structure of the gene encoding the human cyclin-dependent kinase inhibitor p18 and mutational analysis in breast cancer.
9537438 1998 Analysis of CDKN2A, CDKN2B, CDKN2C, and cyclin Ds gene status in hepatoblastoma.
9437433 1998 Crystal structure of the CDK4/6 inhibitory protein p18INK4c provides insights into ankyrin-like repeat structure/function and tumor-derived p16INK4 mutations.
8840966 1996 A p18 mutant defective in CDK6 binding in human breast cancer cells.
8663131 1996 Biochemical characterization of p16INK4- and p18-containing complexes in human cell lines.
8647873 1996 Characterization of p18, a component of the lamin B receptor complex and a new integral membrane protein of the avian erythrocyte nuclear envelope.
8397372 1993 Expression of the leukemia-associated gene, p18, in normal and malignant tissues; inactivation of expression in a patient with cleaved B cell lymphoma/leukemia.
8259215 1993 A new regulatory motif in cell-cycle control causing specific inhibition of cyclin D/CDK4.
8001816 1994 Growth suppression by p18, a p16INK4/MTS1- and p14INK4B/MTS2-related CDK6 inhibitor, correlates with wild-type pRb function.