Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.39
PubTator Score 8.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
spina bifida 1064 4.3e-02
Disease Target Count Z-score Confidence
Cardiovascular system disease 194 0.0 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
spina bifida -2.015 4.3e-02

Gene RIF (10)

PMID Text
26531822 The results suggest that CARF regulates early steps of pre-rRNA processing during ribosome biogenesis by controlling spatial distribution of XRN2 between the nucleoplasm and nucleolus.
26278998 CARF promotes carcinogenesis in p53-deficient cells by repressing p21WAF1 and promoting cell cycle progression.
24825908 CARF regulates proliferative fate of human cells by dose-dependent regulation of DNA damage signaling.
22552337 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.
21052095 CARF knockdown elicited DNA damage response as evidenced by increased levels of phosphorylated ATM and gammaH2AX, leading to induction of mitotic arrest and eventual apoptosis.
19001376 CARF plays a dual role in regulating p53-mediated senescence and apoptosis, the two major tumor suppressor mechanisms.
18555516 CARF may act as a novel key regulator of the p53 pathway at multiple checkpoints
18292944 CARF exerts a vital control on the p53-HDM2-p21WAF1 pathway that is frequently altered in cancer cells.
17460193 CARF may exert a vital control on p53-HDM2-p21(WAF1) pathway that is central to the cell cycle control, senescence, and DNA damage response of human cells
12154087 cooperates with human p14ARF in activating p53

AA Sequence

MAQEVSEYLSQNPRVAAWVEALRCDGETDKHWRHRRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNR      1 - 70
QLQQLISFSMAWANHVFLGCRYPQKVMDKILSMAEGIKVTDAPTYTTRDELVAKVKKRGISSSNEGVEEP     71 - 140
SKKRVIEGKNSSAVEQDHAKTSAKTERASAQQENSSTCIGSAIKSESGNSARSSGISSQNSSTSDGDRSV    141 - 210
SSQSSSSVSSQVTTAGSGKASEAEAPDKHGSASFVSLLKSSVNSHMTQSTDSRQQSGSPKKSALEGSSAS    211 - 280
ASQSSSEIEVPLLGSSGSSEVELPLLSSKPSSETASSGLTSKTSSEASVSSSVAKNSSSSGTSLLTPKSS    281 - 350
SSTNTSLLTSKSTSQVAASLLASKSSSQTSGSLVSKSTSLASVSQLASKSSSQTSTSQLPSKSTSQSSES    351 - 420
SVKFSCKLTNEDVKQKQPFFNRLYKTVAWKLVAVGGFSPNVNHGELLNAAIEALKATLDVFFVPLKELAD    421 - 490
LPQNKSSQESIVCELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKVVVKICKRKYRGSEIEDLVLL    491 - 560
DEESRPVNLPPALKHPQELL                                                      561 - 580
//

Text Mined References (27)

PMID Year Title
26531822 2015 Collaborator of alternative reading frame protein (CARF) regulates early processing of pre-ribosomal RNA by retaining XRN2 (5'-3' exoribonuclease) in the nucleoplasm.
26278998 2015 CARF (Collaborator of ARF) overexpression in p53-deficient cells promotes carcinogenesis.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24825908 2014 Collaborator of ARF (CARF) regulates proliferative fate of human cells by dose-dependent regulation of DNA damage signaling.
24485912 2014 Molecular characterization of collaborator of ARF (CARF) as a DNA damage response and cell cycle checkpoint regulatory protein.
24462208 2014 PAXT-1 promotes XRN2 activity by stabilizing it through a conserved domain.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22552337 2012 Analysis of indel variations in the human disease-associated genes CDKN2AIP, WDR66, USP20 and OR7C2 in a Korean population.
21269460 2011 Initial characterization of the human central proteome.
21052095 2011 Molecular characterization of apoptosis induced by CARF silencing in human cancer cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19001376 2009 CARF Is a vital dual regulator of cellular senescence and apoptosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18555516 CARF: an emerging regulator of p53 tumor suppressor and senescence pathway.
18292944 2008 CARF (collaborator of ARF) interacts with HDM2: evidence for a novel regulatory feedback regulation of CARF-p53-HDM2-p21WAF1 pathway.
17460193 2007 CARF binds to three members (ARF, p53, and HDM2) of the p53 tumor-suppressor pathway.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16803988 2006 CARF regulates p19ARF-p53-p21WAF1 senescence pathway by multiple checkpoints.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15109303 2004 Alternative reading frame protein (ARF)-independent function of CARF (collaborator of ARF) involves its interactions with p53: evidence for a novel p53-activation pathway and its negative feedback control.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12581788 2003 A novel putative collaborator of p19ARF.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12154087 2002 CARF is a novel protein that cooperates with mouse p19ARF (human p14ARF) in activating p53.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.