Property Summary

NCBI Gene PubMed Count 159
PubMed Score 600.46
PubTator Score 470.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
IMAGe syndrome 6 5.937 3.0

Expression

  Differential Expression (30)

Disease log2 FC p
gastric cancer -1.100 1.1e-02
pancreatic cancer -1.900 2.6e-04
malignant mesothelioma 3.100 1.5e-07
ependymoma -1.800 4.9e-02
psoriasis -1.100 1.0e-05
osteosarcoma 1.690 3.1e-02
Atopic dermatitis -1.100 2.1e-03
adrenocortical carcinoma -2.749 1.4e-04
tuberculosis and treatment for 3 months 2.100 7.2e-05
non-small cell lung cancer -1.557 4.4e-14
Common variable immunodeficiency -1.223 1.4e-02
intraductal papillary-mucinous adenoma (... -1.300 1.1e-02
intraductal papillary-mucinous carcinoma... -1.900 5.2e-03
active ulcerative colitis 1.204 4.8e-02
breast carcinoma -2.000 5.5e-06
fibroadenoma -1.300 2.9e-03
group 4 medulloblastoma -2.400 2.1e-03
non primary Sjogren syndrome sicca 1.100 1.6e-02
pancreatic carcinoma -1.900 2.6e-04
aldosterone-producing adenoma -1.370 2.2e-03
subependymal giant cell astrocytoma -2.624 5.5e-03
lung adenocarcinoma -1.800 1.1e-09
invasive ductal carcinoma -2.800 5.4e-03
Breast cancer -2.200 1.3e-12
ductal carcinoma in situ -2.000 1.8e-04
ovarian cancer -2.100 7.1e-06
pituitary cancer -1.400 5.5e-04
Down syndrome 1.100 1.4e-02
chronic rhinosinusitis -2.048 2.6e-03
head and neck cancer -1.400 5.8e-04

 GO Component (2)

Gene RIF (138)

PMID Text
26606000 Jab1/Csn5 expression with concurrent low p57 expression associated with poor overall survival in hepatocellular carcinoma
26362858 These results indicate that the inhibitory effect of rapamycin may be due mainly to increased p14, p15, and p57 expression via promoter demethylation and decreased mTOR and p70S6K expression in ALL cell lines.
26271467 Our data indicated that reduced cytoplasmic p57 expression is associated with hepatocellular carcinoma invasion.
26161420 Polymer-based immunohistochemical staining of p57(kip2) (paternally imprinted gene, expressed from maternal allele) is a very effective method that can be used to differentiate androgenetic complete mole from partial mole and hydropic abortion.
26091021 Using human placental samples, we show that the expression of the imprinted gene CDKN1C associates with birth weight
26077438 CDKN1C sequencing should be performed for BWS patients presenting with abdominal wall defects or cleft palate without 11p15 methylation defects or body asymmetry, or in familial cases of BWS.
25960208 downregulation of CDKN1 by siRNA blocked the activity of miR-25 on promoting glioma cell proliferation.
25588980 Up-regulation of miR-199a-5p in ADPKD tissues might promote cell proliferation through suppressing CDKN1C
25427884 Data show the presence of maternally derived extra copies of the distal chromosome 11p involving the wild-type cyclin-dependent kinase inhibitor 1C protein (CDKN1C).
25339094 Lefty1 could regulates the cell cycle via modulating the expressions of P57 and cyclin D1 and then inhibit the decidualization in vitro.
25262539 opposed functional mutations in CDKN1C cause opposite clinical features; loss-of-function mutations cause overgrowth; gain-of-function mutations in the PCNA domain result in growth restriction; only maternally inherited mutations in CDKN1C are associated with disturbed growth [review]
25216674 This report shows that p57(Kip2) is a novel target of miR-21 in prostate cancer and revealing a novel oncogenic function of this microRNA.
25195859 p57Kip2 has a role in DNA damage response, suppresses tumorigenesis and causes chemoresistance.
25057881 We report a novel CDKN1C mutation associated with features of IMAGe syndrome, but without adrenal insufficiency or metaphyseal dysplasia, and characterized by early-adulthood-onset diabetes.
24986528 The gene expression pattern of CDKN1C, H19, IGF2, KCNQ1 and PHLDA2 genes was evaluated using RT-PCR.
24852133 Staining intensities of cell cycle inhibitors p27 and p57 significantly increased in all parts of preeclamptic placentas compared to control
24848107 p57 and p21 serve nonredundant functions in trophoblast giant cells; the role of p21 in suppressing apoptosis is restricted to terminally differentiated cells.
24652995 p57 regulates T-cell development and prevents lymphomagenesis by balancing p53 activity and pre-TCR signaling.
24613849 In conclusion, combined p57 immunostaining and FISH with a set of 3 CEP probes for chromosomes X, Y, and 17 could be useful in the classification of hydatidiform moles.
24098681 Increased protein stability of CDKN1C causes a gain-of-function phenotype in patients with IMAGe syndrome.
24065356 A report of a novel mutation of CDKN1C affecting the PCNA-binding domain in a family with a history of Russell Silver syndrome.
23963898 cell cycle related proteins PCNA, Ki67, cyclin D3, p27 and p57 were expressed in both normal and diabetic human term placentas.
23887308 p57 expression is highly correlated with genotyping, serves as a reliable marker for diagnosis of complete hydatidiform moles
23842948 This study indicates that the abnormal expression of p57 and RhoA contributes to progression of hepatocellular carcinoma and poor survival of patients.
23828667 p57kip2 appears to be widely expressed in the human oligodendroglial lineage, and potential beneficial effects on remyelination in the mulltiple sclerosis brain are not based on subcellular p57kip2 localization shifts.
23580324 p15(INK4b) and p57(KIP2) may be involved in the progression of vulvar carcinomas and the combined p14(ARF)/p15(INK4b)/p16(INK4a) status was a statistically independent prognostic factor.
23438793 The co-expression of p27 and p57 by extravillous cytotrophoblasts and their positive correlation in non-molar gestations may indicate its suppressive role on the proliferation of these cells to provide them the capacity for differentiation and invasion.
23421998 These data suggest that HER2/Akt is an important negative regulator of p57 (Kip2), and that p57 restoration in HER2-overexpressing cells can reduce breast tumor growth.
23244105 High p57 KIP2 is asociated with breast cancer.
23197429 A novel mutation in CDKN1C was found in a family with Beckwith-Wiedemann syndrome and cleft palate, sensorineural hearing loss, and supernumerary flexion creases.
23187808 Data suggest that CSN6 is an important negative regulator of p57 (Kip2) , and that overexpression of CSN6 in many types of cancer could lead to decreased expression of p57 (Kip2) and result in promoted cancer cell growth.
23171462 Downregulation of CDKN1C is associated with poor disease outcome in patients with cutaneous T-cell lymphoma, while upregulation of AHI1 shows a weak association with aggressive disease course.
23153226 Based on these findings we conclude that the imprinted gene expression of KCNQ1OT1, CDKN1C, H19, and PLAGL1 are conserved between human and bovine
23008285 Cdkn1c (p57/KIP2) is a novel regulator of early epidermal differentiation and controls proliferation in primary keratinocytes and HaCaT cells.
22992698 Report reproducibility of p57 immunohistochemistry and molecular genotyping in the diagnosis of hydatidiform moles.
22980580 Co-culture of CB CD34(+) cells with mesenchymal stromal cells, especially in the absence of cytokines, maintained mRNA expression of p21 and p57 genes in ex vivo expanded CD34(+) cells.
22705236 Down-regulation of Notch1 and Notch3 in two hepatocellular carcinoma cell lines resulted in Hes1 down-regulation, CDKN1C/P57 up-regulation, and reduced cell growth.
22634751 All IMAGe-associated mutations clustered in the PCNA-binding domain of CDKN1C and resulted in loss of PCNA binding.
22592318 The p57(KIP2-)mediated stabilization of the actin cytoskeleton was associated with the displacement of hexokinase-1 from the mitochondria, providing a possible mechanism for the promotion of the mitochondrial apoptotic cell death pathway.
22569127 A novel function was uncovered for p57 that integrates external signals transduced by p38 stress-activated protein kinase to control the cell-cycle, establishing a checkpoint in G1 which is critical to permit cellular adaptation to stress.
22541097 Low expression of p57kip2 gene may play a role in the pathogenesis of myelodysplastic syndrome.
22394561 Signaling through the PI3K (phosphatidylinositol 3-kinase)-Akt-mTOR (mammalian target of rapamycin) pathway was necessary and sufficient for the increase in p57Kip2
22292406 The decreased expression of P57(kip2) and Maspin in abnormal scar shows that they are cicatrix-related genes. There is a positive relationship between the two genes.
22245958 Report role of p57 immunohistochemistry and molecular genotyping to improve diagnostic reproducibility of hydatidiform moles.
22233925 Cyclin-dependent kinase inhibitor p57(Kip2) is a candidate biomarker of platinum sensitivity/resistance in EOC and such cases may show preferential response to the cyclin-dependent kinase inhibitor seliciclib.
22205991 deletion of enhancer elements required for CDKN1C expression lying within or close to the imprinting centre
22197173 Case Report: Combination of p57(kip2) immunostaining and HER2 fluorescent in situ hybridization was useful in diagnosing complete hydatidiform mole in a perimenopausal woman.
22126772 MIR221 can interact with the target site on the 3'-UTR of CDKN1C/p57 mRNA to inhibit CDKN1C/p57 expression by post-transcriptional gene silencing to promote colon carcinoma cell proliferation.
22079941 Beckwith-Wiedemann syndrome patients that inherited a maternal translocation or inversion of chromosome 11 also demonstrated reduced expression of the growth suppressing imprinted gene, CDKN1C.
22064387 Upregulation of p57(kip2) may play an important role in the decidual differentiation by progesterone and growth inhibition of malignant cells in human endometrium.
22002319 downregulation of p57 accelerates the growth and invasion of HCC, indicating that p57 is an important tumor suppressor in HCC. Based on these findings, p57 may be a potential target for HCC prevention and therapy
21816904 We particularly focus our attention on p57(Kip2) changes in cancers and pharmacological approaches for modulating p57(Kip2) levels.
21769918 Through MEK/ERK pathway, S1P stimulates GAP43 transcription with increased binding of C/EBPbeta to the 5'-promoter tumor cell for metastais
21767919 We confirm that for distinguishing complete hydatidiform mole from its mimics, p57(KIP2) immunohistochemistry can be used as successfully as DNA microsatellite genotyping
21575583 The different LH subdomains, despite their sequence and thermodynamic differences, play similar roles in binding and inhibiting Cdk2/cyclin A.
21538272 miR-221 inhibits CDKN1C/P57 expression by post-transcriptional gene silencing to promote colorectal carcinoma development and progression.
21371741 reduced immunostaining of PCNA and Ki67 and increased immunostaining of p27 and p57 in the dexamethasone-induced intrauterine growth restriction placental development compared to control placental development
21360479 expression levels of p57(KIP2) and TGF-beta 1 associated with histological type of lung cancer; expression levels of decorin and p57(KIP2)associated with lymphatic invasion; increased expression of decorin and p57(KIP2) correlated with increased survival
21278784 MiR-221 binds to the target site in the 3'-UTR of the CDKN1C/p57 mRNA to inhibit CDKN1C/p57 expression by post-transcriptional gene silencing to promote colorectal carcinoma occurrence and progress
21205084 EZH2 gene acts as an oncogene in tumorigenesis of ovarian cancer with the possible mechanism to suppress the anti-oncogene p57.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20626178 The androgenetic/biparental chimeric Complete Hydatidiform moles demonstrated a negative p57(KIP2)(cyclin-dependent kinase inhibitor 1C) staining pattern for the androgenetic cells and positive staining for the biparental cells
20565244 High levels of CDKN1C expression are common in human retinoblastoma tumors (RB).
20503313 these findings suggest that Beckwith-Wiedemann syndrome patients with CDKN1C mutations have a different pattern of clinical malformations than those with other molecular defects.
20484977 Gene expression pattern of CDKN1C imprinted genes in spontaneous miscarriages or fetal deaths.
20106982 CDKN1C negatively regulates RNA polymerase II C-terminal domain phosphorylation in an E2F1-dependent manner
20056082 The degradation of cholesterol didn't affect the level of p57 in cell membrane.
19734939 the p57(Kip2) control of LIMK-1 ultimately affects cell mobility negatively.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19616848 methylation of the p57KIP2 gene was analyzed in 63 cases of DLBCL by methylation-specific real-time quantitative PCR. Methylation of the p57KIP2 gene was detected in 53 (84.1%) of these 63 cases of DLBCL
19590511 Cyclin-Dependent Kinase Inhibitor p57 repressed Mash1 transcriptional activity, and the interaction with Mash1 as well as the repression of transcriptional activity turned out to be independent of cyclin dependent kinase interactions.
19571260 Conservation of maternal allele-specific expression of CDKN1C in humans, mice and swine is supported by expression profiling between swine parthenotes and biparental control fetuses.
19544458 Data show that the miRNA miR-92b directly downregulates protein levels of the G(1)/S checkpoint gene p57.
19544095 KLF4 binds to the p57(Kip2) promoter and transcriptionally upregulates its expression, which in turn inhibits the stress activated protein kinase cascade and c-Jun phosphorylation.
19542869 We recommend use of p57 immunohistochemistry and molecular genotyping to evaluate all products of conception specimens for which there is any consideration of a diagnosis of hydatidiform mole.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19386358 CDKN1C mutations in children born to women with preeclampsia/HELLP syndrome; suggesting the involvement of an imprinted gene in the pathophysiology of preeclampsia
19340297 study reveals a novel epigenetic mechanism governing CDKN1C repression in breast cancer. As a newly identified EZH2 target with prognostic value, it has implications in patient stratification for cancer therapeutic targeting EZH2-mediated gene repression
19221586 Results show that the imprinted cell cycle inhibitor CDKN1C is a downstream target for SMARCB1 and is transcriptionally activated by increased histone H3 and H4 acetylation at the promoter.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19145201 This study validates p57 immunostaining as a prospectively applicable triage assay for the diagnosis of complete hydatidiform mole
19141585 Observational study of gene-disease association. (HuGE Navigator)
19116812 The loss of p57 expression in placental mesenchymal dysplasia could be of diagnostic value in helping to distinguish this rare placental lesion from its mimickers.
19109226 Detection of epigenetic alterations allows the identification of patients with ALL with standard risk but with poor prognosis.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18822693 p57(Kip2) down-regulation is a well-established feature of urothelial carcinoma. Probably, this down-regulation of cyclin-dependent kinase inhibitors supports the proliferation phase of oncogenesis.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18647205 The difference in expression patterns of p27(KIP1) and p57(KIP2) in proliferating and senescent melanocytes suggests the interplay between these proteins may play a functional role in melanocytic tumorigenesis
18521080 miR-221 has an oncogenic function in hepatocarcinogenesis by targeting CDKN1B/p27 and CDKN1C/p57, hence promoting proliferation by controlling cell-cycle inhibitors.
18430730 cyclin-dependent kinase inhibitor p57(Kip2) and vascular endothelial growth factor mRNAs are selectively translated by an IRES-independent mechanism under hypoxic stress
18325103 The expression of CDKN1C decreases in the large majority of breast cancers and does not appear to be mediated by AI/LOH at the gene. CDKN1C may be a breast cancer tumor suppressor.
17986608 demonstrate that these myoblasts are unable to complete myogenic differentiation because of an inability to up-regulate p57Kip2 transcription
17885492 We did not find p16, p14, and p57 to be useful as prognostic markers in stage III ovarian cancer
17572845 In this study, P57kip2 immunostaining was absent in the trophoblastic layers of CHM and was positive in the trophoblast layer of nonmolar villi and MD.
17464323 mechanism whereby p57(Kip2) influences the mitochondrial apoptotic cell death pathway in cancer cells
17351341 Observational study of gene-disease association. (HuGE Navigator)
17351341 Genetic evidence links the association between DNA-variants in the CDKN1C gene with a risk of atherosclerosis and myocardial infarction.
17112701 These data demonstrate the role of BMP2 compared to BMP6 in the inhibition of growth and induction of differentiation of keratinocytes; p57(Kip2) and p21(Cip1) have a BMP2/6-induced expression.
17050328 findings suggest p57kip2 may play a role in the regulation of meiotic progression of early spermatocytes & cell cycle arrest & differentiation of spermatids
16950772 CTIP2 associates with the NuRD complex on the promoter of p57KIP2, a newly identified CTIP2 target gene.
16943770 TGF-beta1 and/or TGF-beta2 inhibit proliferation of primary cultured human limbal epithelial cells, and p57 and p15 play roles in this process.
16936778 These results suggest that the tumor suppressive properties of p57KIP2 in leukemia may depend on the intrinsic promoter DNA methylation status of the gene.
16705184 Global gene expression analysis in neuroblastoma cells engineered to acutely express the E protein E47 and Id2, showed that p57Kip2 is a target of E47.
16575194 Recent advances in epigenetic control of the CDKN1C/KCNQ1OT1 imprinted domain in both humans and mice, causing Beckwith-Wiedemann syndrome and cancer. (review)
16357845 Methylation of p57(KIP2) may contribute to the malignant progression of gastric MALT lymphomas.
16124066 The decreased expression of p57(kip2) and/or overexpression of cyclinE protein and PCNA may contribute to the occurrence and progression of pancreatic cancer.
16061564 The absence of methylation and repressive chromatin structure at the CDKN1C promoter in Beckwith-Wiedemann Syndrome patients with loss of methylation at KvDMR1 suggests a direct role of this epimutation in silencing CDKN1C.
15985436 identification of a novel p73-Kip2/p57 pathway that coordinates mitotic exit and transition to G1
15978938 The P57 was methylated in 2 (10%) pediatric patients , compared to 20 (37%)respectively in adult patients.
15952111 Transcripts of P57KIP2, imprinted genes related to BWS, were detected in human oocytes and at all stages of preimplantation embryos.
15936816 The Cyclin-Dependent Kinase Inhibitor p57 plays key roles in cell cycle regulation, and was methylation-negative in myeloid neoplasia.
15900410 endothelial cells of infantile hemangiomas not associated with Beckwith-Wiedemann syndrome normally express p57(KIP2) while chorioangiomas do not
15888726 p57KIP2 is part of an imprinted gene network that may play a role in Beckwith-Wiedemann syndrome.
15821902 Observational study of gene-disease association. (HuGE Navigator)
15821902 Variants in CDKN1C may contribute to the inter-individual variation in birth weight.
15749785 p57 is up-regulated in the process of decidualization.
15492797 Aberrant methylation of p57KIP2 gene is associated with lung and breast cancers and malignant mesotheliomas
15332324 p57KIP2 was weakly expressed in 4/6 glioblastoma (GBM) specimens by western blot. p57KIP2 immunoreactivity was positive in 8/40 GBMs, and was primarily nuclear in location. The motility of glioma cells was significantly reduced after p57KIP2 induction.
15007390 Diminished CDKN1C expression is associated with loss of methylation of CpG & H3K9 at DMR-LIT1, & is involved in esophageal cancer. DMR-LIT1 epigenetically regulates CDKN1C expression through histone modifications at DMR-LIT1 promoter.
14627666 An epimutation at KvDMR1, the absence of maternal methylation, causes the aberrant silencing of CDKN1C, some 180 kb away on the maternal chromosome.
14612924 loss of p57KIP2 expression appears associated with colorectal carcinogenesis
14530263 p57 may act as a key regulator in embryogenesis by regulating cell cycle through binding to Cdks and the regulating actin dynamics through binding to LIMK-1
12963725 p57KIP2 modulates stress-activated signaling by functioning as an endogenous inhibitor of JNK/SAPK
12947099 it is evident that B-Myb protein may promote cell proliferation by a non-transcriptional mechanism that involves release of active cyclin/cyclin dependent kinase 2 from cyclin-dependent inhibitor 1C p57(KIP2)
12925736 SCFSkp2 complex plays an important role in cell-cycle progression by determining the abundance of p57Kip2 and that of the related CDK inhibitor p27Kip1.
12790805 identified a functional glucocorticoid response element, located 5 kilo bases upstream of the transcription start site in the human p57(Kip2) promoter
12586619 frequently methylated in adult patients with ALL, and that inactivation of a pathway composed of p73, p15, and p57KIP2 predicts for poor prognosis in Ph-negative patients
12553041 P57/KIP2 is a determinant pro-survival factor for cell protection from green tea polyphenol-induced apoptosis.
12532471 Expression of p57kip2, Rb protein and PCNA and their relationships with clinicopathology in human pancreatic cancer.
12514787 findings support the hypothesis that misexpression of p57 is involved in the abnormal development of androgenetic complete moles
12239171 aberrant DNA methylation of the gene occurs in the promoter region in lymphoid malignancies of B-cell phenotype
11965547 DNA methylation and histone deacetylation of p57KIP2 promoter results in gene silencing of p57KIP2 in human tumors
11891530 Down-regulation of p57 may play a role in the dedifferentiation of thyroid carcinoma.
11891335 Induction of p57(KIP2) expression by p73beta
11815601 Identification and functional characterization of an intragenic DNA binding site for the spumaretroviral trans-activator in the human p57Kip2 gene
8610162 CDKN1C gene is imprinted, with preferential expression from the maternal allele.

AA Sequence

MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMP      1 - 70
LRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVP     71 - 140
VPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAP    141 - 210
APAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRK    211 - 280
RSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR                                      281 - 316
//

Text Mined References (157)

PMID Year Title
26606000 2016 Down-regulation of the cyclin-dependent kinase inhibitor p57 is mediated by Jab1/Csn5 in hepatocarcinogenesis.
26362858 2015 Rapamycin restores p14, p15 and p57 expression and inhibits the mTOR/p70S6K pathway in acute lymphoblastic leukemia cells.
26271467 2015 The role of cytoplasmic p57 in invasion of hepatocellular carcinoma.
26161420 2015 Clinical Usefulness of Immunohistochemical Staining of p57 kip2 for the Differential Diagnosis of Complete Mole.
26091021 2015 Placental 5-methylcytosine and 5-hydroxymethylcytosine patterns associate with size at birth.
26077438 2015 Mutations of the Imprinted CDKN1C Gene as a Cause of the Overgrowth Beckwith-Wiedemann Syndrome: Clinical Spectrum and Functional Characterization.
25960208 2015 miR-25 promotes glioma cell proliferation by targeting CDKN1C.
25588980 2015 Inhibition of MiR-199a-5p reduced cell proliferation in autosomal dominant polycystic kidney disease through targeting CDKN1C.
25427884 2015 Silver-Russell syndrome without body asymmetry in three patients with duplications of maternally derived chromosome 11p15 involving CDKN1C.
25339094 2014 Lefty inhibits in vitro decidualization by regulating P57 and cyclin D1 expressions.
25262539 2014 CDKN1C mutations: two sides of the same coin.
25216674 2014 MicroRNA-21 inhibits p57Kip2 expression in prostate cancer.
25195859 2015 p57Kip2 is an unrecognized DNA damage response effector molecule that functions in tumor suppression and chemoresistance.
25057881 2014 A novel variant in CDKN1C is associated with intrauterine growth restriction, short stature, and early-adulthood-onset diabetes.
24986528 2014 Relevance of genomic imprinting in intrauterine human growth expression of CDKN1C, H19, IGF2, KCNQ1 and PHLDA2 imprinted genes.
24852133 2014 The expression of cell cycle related proteins PCNA, Ki67, p27 and p57 in normal and preeclamptic human placentas.
24848107 2014 Cytoplasmic localization of p21 protects trophoblast giant cells from DNA damage induced apoptosis.
24652995 2014 p57 regulates T-cell development and prevents lymphomagenesis by balancing p53 activity and pre-TCR signaling.
24613849 2014 Utility of fluorescence in situ hybridization for ploidy and p57 immunostaining in discriminating hydatidiform moles.
24098681 2013 Increased protein stability of CDKN1C causes a gain-of-function phenotype in patients with IMAGe syndrome.
24065356 2013 CDKN1C mutation affecting the PCNA-binding domain as a cause of familial Russell Silver syndrome.
23963898 2014 Immunohistochemical distribution of cell cycle proteins p27, p57, cyclin D3, PCNA and Ki67 in normal and diabetic human placentas.
23887308 2014 Characteristics of hydatidiform moles: analysis of a prospective series with p57 immunohistochemistry and molecular genotyping.
23842948 2013 Loss of p57 expression and RhoA overexpression are associated with poor survival of patients with hepatocellular carcinoma.
23828667 2013 Oligodendroglial lineage cells express nuclear p57kip2 in multiple sclerosis lesions.
23580324 2013 Expression of p15INK?b and p57KIP² and relationship with clinicopathological features and prognosis in patients with vulvar squamous cell carcinoma.
23438793 2013 The diagnostic value of p27 in comparison to p57 in differentiation between different gestational trophoblastic diseases.
23421998 2013 CDK inhibitor p57 (Kip2) is downregulated by Akt during HER2-mediated tumorigenicity.
23244105 2012 Clinical implications of p57 KIP2 expression in breast cancer.
23197429 2013 A novel mutation in CDKN1C in sibs with Beckwith-Wiedemann syndrome and cleft palate, sensorineural hearing loss, and supernumerary flexion creases.
23187808 2012 CDK inhibitor p57 (Kip2) is negatively regulated by COP9 signalosome subunit 6.
23171462 2012 The role of AHI1 and CDKN1C in cutaneous T-cell lymphoma progression.
23153226 2012 Expression of KCNQ1OT1, CDKN1C, H19, and PLAGL1 and the methylation patterns at the KvDMR1 and H19/IGF2 imprinting control regions is conserved between human and bovine.
23008285 Cell cycle regulator Cdkn1c (p57/KIP2) shows distinct expression in epidermal differentiation.
22992698 2012 Diagnostic reproducibility of hydatidiform moles: ancillary techniques (p57 immunohistochemistry and molecular genotyping) improve morphologic diagnosis for both recently trained and experienced gynecologic pathologists.
22980580 2013 mRNA expression and promoter DNA methylation status of CDKi p21 and p57 genes in ex vivo expanded CD34 (+) cells following co-culture with mesenchymal stromal cells and growth factors.
22705236 2012 CDKN1C/P57 is regulated by the Notch target gene Hes1 and induces senescence in human hepatocellular carcinoma.
22634751 2012 Mutations in the PCNA-binding domain of CDKN1C cause IMAGe syndrome.
22592318 2012 p57(KIP2) control of actin cytoskeleton dynamics is responsible for its mitochondrial pro-apoptotic effect.
22569127 2012 The p57 CDKi integrates stress signals into cell-cycle progression to promote cell survival upon stress.
22541097 2012 [Expression of p57kip2 in patients with de novo myelodysplastic syndrome and its relationship with SDF-1/CXCR4 axis].
22394561 2012 Akt and ERK control the proliferative response of mammary epithelial cells to the growth factors IGF-1 and EGF through the cell cycle inhibitor p57Kip2.
22292406 2011 [Expression and significance of P57(kip2) and Maspin in pathological scar].
22245958 2012 Diagnostic reproducibility of hydatidiform moles: ancillary techniques (p57 immunohistochemistry and molecular genotyping) improve morphologic diagnosis.
22233925 2012 The cyclin-dependent kinase inhibitor p57(Kip2) is epigenetically regulated in carboplatin resistance and results in collateral sensitivity to the CDK inhibitor seliciclib in ovarian cancer.
22205991 2011 An 11p15 imprinting centre region 2 deletion in a family with Beckwith Wiedemann syndrome provides insights into imprinting control at CDKN1C.
22197173 2012 A case of complete hydatidiform mole in a perimenopausal woman with diagnostic usefulness of p57(kip2) immunohistochemistry and HER2 fluorescent in situ hybridization.
22126772 2011 [MicroRNA-221 promotes colon carcinoma cell proliferation in vitro by inhibiting CDKN1C/p57 expression].
22079941 2012 Maternal gametic transmission of translocations or inversions of human chromosome 11p15.5 results in regional DNA hypermethylation and downregulation of CDKN1C expression.
22064387 2012 Cyclic changes in the expression of p57(kip2) in human endometrium and its regulation by steroid hormones in endometrial stromal cells in vitro.
22002319 2011 Downregulation of p57 accelerates the growth and invasion of hepatocellular carcinoma.
21816904 2011 p57(Kip2) and cancer: time for a critical appraisal.
21769918 2011 Downregulation of p57kip² promotes cell invasion via LIMK/cofilin pathway in human nasopharyngeal carcinoma cells.
21767919 2011 The usefulness of p57(KIP2) immunohistochemical staining and genotyping test in the diagnosis of the hydatidiform mole.
21575583 2011 The role of the LH subdomain in the function of the Cip/Kip cyclin-dependent kinase regulators.
21538272 2011 [MicroRNA-221 controls CDKN1C/P57 expression in human colorectal carcinoma].
21371741 2012 Immunolocalization of PCNA, Ki67, p27 and p57 in normal and dexamethasone-induced intrauterine growth restriction placental development in rat.
21360479 Decreased expression of decorin and p57(KIP2) correlates with poor survival and lymphatic metastasis in lung cancer patients.
21278784 2011 MicroRNA-221 inhibits CDKN1C/p57 expression in human colorectal carcinoma.
21205084 2011 EZH2 regulates expression of p57 and contributes to progression of ovarian cancer in vitro and in vivo.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20626178 Simultaneous detection of imprinted gene expression (p57(KIP2)) and molecular cytogenetics (FICTION) in the evaluation of molar pregnancies.
20565244 2010 CDKN1C (p57KIP2) mRNA expression in human retinoblastomas.
20503313 2010 CDKN1C (p57(Kip2)) analysis in Beckwith-Wiedemann syndrome (BWS) patients: Genotype-phenotype correlations, novel mutations, and polymorphisms.
20484977 2010 Gene expression pattern of IGF2, PHLDA2, PEG10 and CDKN1C imprinted genes in spontaneous miscarriages or fetal deaths.
20106982 2010 CDKN1C negatively regulates RNA polymerase II C-terminal domain phosphorylation in an E2F1-dependent manner.
20056082 2010 [Analysis on the relationship between p57 and cholesterol in cellular membrane].
19734939 2009 The Cdk inhibitor p57(Kip2) controls LIM-kinase 1 activity and regulates actin cytoskeleton dynamics.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19616848 2010 Aberrant DNA methylation of the p57KIP2 gene is a sensitive biomarker for detecting minimal residual disease in diffuse large B cell lymphoma.
19590511 2009 p57Kip2 is a repressor of Mash1 activity and neuronal differentiation in neural stem cells.
19571260 2009 Characterization of conserved and nonconserved imprinted genes in swine.
19544458 2009 MicroRNA 92b controls the G1/S checkpoint gene p57 in human embryonic stem cells.
19544095 2009 KLF4 suppresses HDACi induced caspase activation and the SAPK pathway by targeting p57(Kip2).
19542869 2009 Complete hydatidiform mole with retained maternal chromosomes 6 and 11.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19386358 2009 CDKN1C mutations in HELLP/preeclamptic mothers of Beckwith-Wiedemann Syndrome (BWS) patients.
19340297 2009 CDKN1C (p57) is a direct target of EZH2 and suppressed by multiple epigenetic mechanisms in breast cancer cells.
19221586 2009 Imprinted CDKN1C is a tumor suppressor in rhabdoid tumor and activated by restoration of SMARCB1 and histone deacetylase inhibitors.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19170105 2009 CDK inhibitors selectively diminish cell cycle controlled activation of the histone H4 gene promoter by p220NPAT and HiNF-P.
19145201 2009 Diagnosis and subclassification of hydatidiform moles using p57 immunohistochemistry and molecular genotyping: validation and prospective analysis in routine and consultation practice settings with development of an algorithmic approach.
19141585 2009 Rare germline mutations in cyclin-dependent kinase inhibitor genes in multiple endocrine neoplasia type 1 and related states.
19116812 2009 Immunohistochemical expression of p57 in placental vascular proliferative disorders of preterm and term placentas.
19109226 2009 Residual DNA methylation at remission is prognostic in adult Philadelphia chromosome-negative acute lymphocytic leukemia.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18822693 Significance of p57(Kip2) down-regulation in oncogenesis of bladder carcinoma: an immunohistochemical study.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660753 2008 A new ubiquitin ligase involved in p57KIP2 proteolysis regulates osteoblast cell differentiation.
18647205 2009 Different expression patterns of p27 and p57 proteins in benign and malignant melanocytic neoplasms and in cultured human melanocytes.
18521080 2008 MiR-221 controls CDKN1C/p57 and CDKN1B/p27 expression in human hepatocellular carcinoma.
18430730 2008 Hypoxia-mediated selective mRNA translation by an internal ribosome entry site-independent mechanism.
18325103 2008 CDKN1C/p57kip2 is a candidate tumor suppressor gene in human breast cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17986608 2007 PAX3-FOXO1 controls expression of the p57Kip2 cell-cycle regulator through degradation of EGR1.
17885492 2007 The clinical importance of Ki-67, p16, p14, and p57 expression in patients with advanced ovarian carcinoma.
17572845 2007 P57kip2 immunohistochemical expression and ultrastructural findings of gestational trophoblastic disease and related disorders.
17464323 2007 The cell cycle inhibitor p57(Kip2) promotes cell death via the mitochondrial apoptotic pathway.
17351341 2007 Role of the CDKN1A/p21, CDKN1C/p57, and CDKN2A/p16 genes in the risk of atherosclerosis and myocardial infarction.
17112701 2007 BMP2 and BMP6 control p57(Kip2) expression and cell growth arrest/terminal differentiation in normal primary human epidermal keratinocytes.
17050328 Expression of p57kip2 in germ cells and Leydig cells in human testis.
16950772 2006 CTIP2 associates with the NuRD complex on the promoter of p57KIP2, a newly identified CTIP2 target gene.
16943770 2006 Targeted inhibition of p57 and p15 blocks transforming growth factor beta-inhibited proliferation of primary cultured human limbal epithelial cells.
16936778 2007 Differential tumor suppressor properties and transforming growth factor-beta responsiveness of p57KIP2 in leukemia cells with aberrant p57KIP2 promoter DNA methylation.
16705184 2006 E Proteins and Id2 converge on p57Kip2 to regulate cell cycle in neural cells.
16575194 2006 Imprinting disruption of the CDKN1C/KCNQ1OT1 domain: the molecular mechanisms causing Beckwith-Wiedemann syndrome and cancer.
16357845 2006 Methylation of p16(INK4A) and p57(KIP2) are involved in the development and progression of gastric MALT lymphomas.
16289477 2005 The cell cycle regulator p27Kip1 interacts with MCM7, a DNA replication licensing factor, to inhibit initiation of DNA replication.
16124066 2005 Expression of cell cycle regulator p57kip2, cyclinE protein and proliferating cell nuclear antigen in human pancreatic cancer: an immunohistochemical study.
16061564 2005 Alternative mechanisms associated with silencing of CDKN1C in Beckwith-Wiedemann syndrome.
15985436 2005 A role of p73 in mitotic exit.
15978938 2005 Aberrant DNA methylation of a cell cycle regulatory pathway composed of P73, P15 and P57KIP2 is a rare event in children with acute lymphocytic leukemia.
15952111 2005 Expression of imprinted genes related to Beckwith-Wiedemann syndrome in human oocytes and preimplantation embryos.
15936816 2005 Absence of p21(CIP 1), p27(KIP 1) and p 57(KIP 2) methylation in MDS and AML.
15900410 2005 Expression of p57KIP2 in infantile hemangioma.
15888726 2005 ZAC, LIT1 (KCNQ1OT1) and p57KIP2 (CDKN1C) are in an imprinted gene network that may play a role in Beckwith-Wiedemann syndrome.
15821902 2005 Studies of variations of the cyclin-dependent kinase inhibitor 1C and the cyclin-dependent kinase 4 genes in relation to type 2 diabetes mellitus and related quantitative traits.
15749785 2005 Differentiation of endometrial stromal cells in vitro: down-regulation of suppression of the cell cycle inhibitor p57 by HOXA10?
15492797 2004 Aberrant methylation of p57KIP2 gene in lung and breast cancers and malignant mesotheliomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15332324 2004 Inducible expression of p57KIP2 inhibits glioma cell motility and invasion.
15007390 2004 Silencing of imprinted CDKN1C gene expression is associated with loss of CpG and histone H3 lysine 9 methylation at DMR-LIT1 in esophageal cancer.
14671317 2003 p57(Kip2) cooperates with Nurr1 in developing dopamine cells.
14627666 2003 Silencing of CDKN1C (p57KIP2) is associated with hypomethylation at KvDMR1 in Beckwith-Wiedemann syndrome.
14612924 2003 Loss of p57KIP2 is associated with colorectal carcinogenesis.
14530263 2003 p57Kip2 regulates actin dynamics by binding and translocating LIM-kinase 1 to the nucleus.
12963725 2003 p57KIP2 modulates stress-activated signaling by inhibiting c-Jun NH2-terminal kinase/stress-activated protein Kinase.
12947099 2003 The cell cycle-regulated B-Myb transcription factor overcomes cyclin-dependent kinase inhibitory activity of p57(KIP2) by interacting with its cyclin-binding domain.
12925736 2003 Degradation of p57Kip2 mediated by SCFSkp2-dependent ubiquitylation.
12790805 2003 Identification of a functional glucocorticoid response element in the promoter of the cyclin-dependent kinase inhibitor p57Kip2.
12586619 2003 Aberrant DNA methylation of p57KIP2 identifies a cell-cycle regulatory pathway with prognostic impact in adult acute lymphocytic leukemia.
12553041 Induction of p57 is required for cell survival when exposed to green tea polyphenols.
12532471 2003 Expression of p57kip2, Rb protein and PCNA and their relationships with clinicopathology in human pancreatic cancer.
12514787 2002 Immunohistochemical characterization of p57(KIP2) expression in early hydatidiform moles.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12239171 2002 Aberrant DNA methylation of p57(KIP2) gene in the promoter region in lymphoid malignancies of B-cell phenotype.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
11891335 2002 Induction of p57(KIP2) expression by p73beta.
11301189 2001 Novel expression of cyclin-dependent kinase inhibitors in human B-cell precursors.
10764802 2000 Stabilization of MyoD by direct binding to p57(Kip2).
10424811 1999 Analysis of germline CDKN1C (p57KIP2) mutations in familial and sporadic Beckwith-Wiedemann syndrome (BWS) provides a novel genotype-phenotype correlation.
10323243 1999 Functional analysis of the p57KIP2 gene mutation in Beckwith-Wiedemann syndrome.
9465025 1998 Suppression of cell transformation by the cyclin-dependent kinase inhibitor p57KIP2 requires binding to proliferating cell nuclear antigen.
9106657 1997 New functional activities for the p21 family of CDK inhibitors.
8934543 1996 Isolation of a novel GPI-anchored gene specifically regulated by p53; correlation between its expression and anti-cancer drug sensitivity.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8841187 1996 An imprinted gene p57KIP2 is mutated in Beckwith-Wiedemann syndrome.
8655143 1996 Characterization of the human p57KIP2 gene: alternative splicing, insertion/deletion polymorphisms in VNTR sequences in the coding region, and mutational analysis.
8640800 1996 Genomic organization of the human p57KIP2 gene and its analysis in the G401 Wilms' tumor assay.
8610162 1996 Imprinting of the gene encoding a human cyclin-dependent kinase inhibitor, p57KIP2, on chromosome 11p15.
7729684 1995 p57KIP2, a structurally distinct member of the p21CIP1 Cdk inhibitor family, is a candidate tumor suppressor gene.
7729683 1995 Cloning of p57KIP2, a cyclin-dependent kinase inhibitor with unique domain structure and tissue distribution.
1786629 1991 Genes associated with tumor suppression and growth control in the human nervous system.