Property Summary

NCBI Gene PubMed Count 779
PubMed Score 1211.33
PubTator Score 1417.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.305 2.6e-03
Multiple Sclerosis -1.300 1.4e-03
subependymal giant cell astrocytoma -2.371 1.8e-02
psoriasis -1.100 3.2e-11
ovarian cancer -1.600 6.5e-06

Protein-protein Interaction (10)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
463171 other 0 / 0 / 2 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of Wee1 degradation: luminescence-based cell-based assay to identify inhibitors of p27 (CDKN1B) degradation

Gene RIF (728)

PMID Text
27035903 measurements comprising the receptors EGFR, ERBB3 (HER3), and the cyclin-dependent kinase inhibitor p27 (CDKN1B) was found to accurately predict dependence on PI3K/AKT vs. MAPK/ERK signaling axes in HER2+ cancers
26940882 Estrogen-related receptor gamma is upregulated in liver cancer and its inhibition suppresses liver cancer cell proliferation via induction of p21 and p27.
26911146 Data show that KDM5B is frequently up-regulated in hepatocellular carcinoma tissues and cell lines and correlated with poor prognosis. Its depletion leads to highly impaired clonogenesis and cell cycle arrest through up-regulation of p15 and p27.
26874904 These results define a novel mechanism by which PKM2 regulates glioma cell growth, and also define a novel set of potential therapeutic targets along the PKM2-HuR-p27 pathway
26847530 These findings provide evidence that miR-24 has a tumor suppressor role in prostate cancer and also targets p27 and p16 in prostate cancer cells
26775844 These findings provide further evidence that histatin 3 may be involved in the regulation of cell proliferation, particularly during G1/S transition, via the ubiquitin-proteasome system of p27(Kip1) and HSC70.
26701207 p27 overrides Myc's suppression of senescence independent of Ser-62 and induces Myc degradation independent of Cdk2 by binding Myc via its C-terminus. Further, high expression of active p27 protein significantly correlated with low Myc protein level in human breast cancer.
26687548 These findings indicate that NSun2-mediated mRNA methylation regulates p27 and CDK1 levels during replicative senescence.
26682002 HDACIs increase p27(Kip1) by hampering its nuclear ubiquitination/degradation
26677902 Clioquinol suppressed cell cycle progression in the S-phase in SMMC-7721 hepatoma cells via the p21, p27-cyclin E,A/Cdk2 pathway.
26636522 Suppression of p27Kip1 following increased miR-150 expression promotes the development and progression of prostate cancer.
26602816 Data show that heterogeneous nuclear ribonucleoprotein A0 (hnRNPA0) drives chemo-resistance of p53-mutant tumor cells via p27Kip1/Gadd45alpha mRNAs.
26579796 Review and meta-analysis data suggest that carriage of a TG genotype at CDKN1B rs2066827 polymorphism may be associated with decreased susceptibility to cancer.
26528715 MARCKS knockdown arrested VSMC cell cycle by decreasing KIS expression. Decreased KIS expression resulted in nuclear trapping of p27kip1 in VSMCs.
26499333 results implicate Eya4/Six1 regulates normal cardiac function via p27/casein kinase-2alpha/histone deacetylase 2 and indicate that mutations within this transcriptional complex and signaling cascade lead to the development of cardiomyopathy.
26481195 Cx43-Hsc70 interaction regulates cell cycle G1/S progression through a novel mechanism by which Cx43-Hsc70 interaction prevents the nuclear accumulation of p27 through controlling the nuclear translocation of cyclin D1-CDK4-p27 complex.
26471266 DLL4/Notch1 and BMP9 interdependent signaling induces endothelial cell quiescence via P27KIP1/thrombospondin pathway.
26391562 Results show that histological subtyping of pituitary tumor correlated with SSTR2, E cadherin and p27kip protein levels and these may serve as useful biomarkers for prognosis.
26320455 Low expression of KIP1 is associated with Advanced Ovarian Cancer.
26313918 P27 expression mediates drug resistance of gastric cancer cells towards an antineoplastic agent MLN4924; its inhibition reverses the resistance.
26291312 A novel lncRNA, LUADT1, promotes lung adenocarcinoma proliferation via the epigenetic suppression of p27.
26279144 Inhibition of cell cycle entry and progression in a variety of cancers may be achieved with therapies designed to correct p27Kip1 localization and/or block its degradation. (Review)
26254224 COP1 directly interacts with p27 through a VP motif on p27 and functions as an E3 ligase of p27 to accelerate the ubiquitin-mediated degradation of p27. COP1-p27 axis deregulation is involved in tumorigenesis.
26223520 The data demonstrates that PHD3 can drive cell cycle entry at the G1/S transition through decreasing the half-life of p27 that occurs by attenuating p27S10 phosphorylation.
26213845 eIF3a improves ovarian cancer patients' response to cisplatin-based chemotherapy by down regulating XPC and p27(Kip1).
26109559 our findings establish that K17 functions specially among keratins as an oncoprotein by controlling the ability of p27(KIP1) to influence cervical cancer pathogenesis.
26065650 These data identify Hairy cell leukemia (HCL) as having the highest frequency of CDKN1B mutations among cancers and identify CDNK1B as the second most common mutated gene in HCL.
26053093 Data show that cytoplasmic cyclin-dependent kinase inhibitor p27 is preferentially observed in primary non-small cell lung cancer (NSCLC) with activated proto-oncogene proteins c-akt1 and predicts poor survival.
26044523 Data identified p27Kip1 as a direct target of miR-24-3p, and its protein level was negatively regulated by miR-24-3p. This implies that miR-24-3p/p27Kip1 axis has potential as a therapeutic target for breast cancer.
25970772 TEAD4 and KLF5, in collaboration, promoted triple negative breast cancer cell proliferation and tumor growth in part by inhibiting p27 gene transcription
25925673 cyclin D1 and p27 have roles in statin-induced anti-proliferative effects in breast cancer
25894374 Further studies showed that the expression of p27 was dependent on ERK1/2 activation, and p27 itself could halt cell cycle by inhibiting the activation of CDKs
25851349 in lung cancer tissues, upregulation of mdig expression accompanies with the downregulation of p27(KIP1) expression and in bronchial stump
25824098 CDKN1B V109G polymorphism seems to play a role in the development of aggressive tumours in Multiple endocrine neoplasia type 1.
25821107 Our data suggest that p27(Kip1) down-regulation in cervical cancer cells is primarily regulated through PI3K/AKT-mediated proteasomal degradation
25790540 Studied the prognostic value of Ki-67, p27, and p53 immunoreactivity in human gastric cancer.
25788262 Caffeic acid phenethyl ester induced cell cycle arrest and growth inhibition in prostate cancer cells via regulation of Skp2, p53, p21Cip1, and p27Kip1.
25760044 HIV-1 Tat relocalizes cyclin-dependent kinase inhibitor 1B (p27) from nuclear to cytoplasm in neuronal cells
25744729 Rapamycin significantly decreased phosphorylated p70S6K1.
25733683 This study shows that Brk phosphorylates p27KIP1, regulating the activity of cyclin D-cyclin-dependent kinase 4.
25695279 The study suggest that the Cip/Kip family may have a role as a molecular mechanism of carcinogenesis in early glottic cancer.
25675191 Our findings suggest that alteration of p16, p14, p27, p21, and p53 status may contribute to carcinogenesis and the clinical behavior of HPV-negative adenocarcinoma of the uterine cervix
25666480 while p27 expression was similar in the endometriosis and non-endometriosis groups.
25663461 significantly negative correlation between the expression of p27 and Skp2 and between the expression of p27 and p-p27 (Thr187) was observed. Skp2-dependent proteasomal degradation of p27 plays role in the malignant transformation of cholangiocarcinoma
25594310 Data show that Rheb/p27 axis induces autophagy-dependent cancer cell survival under stress conditions.
25587029 p27 accumulated in the cytoplasm of breast cancer cells exclusively in cell lines that are Her2+.
25586243 Somatic Mutations and Genetic Heterogeneity at the CDKN1B Locus is associated with Small Intestinal Neuroendocrine Tumors
25578966 phenotype is due to a prolonged G1/S transition via decreasing DICER-dependent biogenesis of miRNA let-7, which increased the p21(Waf1/Cip1)/p27(Kip1) levels
25572801 the Skp2mediated degradation of p27kip1 was important in the proliferation of tumor cells. The present study, therefore, provided a molecular reference for the treatment of liver cancer.
25566967 we showed that Fenofibrate, a PPARalpha agonist, could inhibit U87MG cell proliferation and induce cell cycle arrest via the PPARa/FoxO1/p27kip pathway.
25536447 Tumor necrosis factor-alpha-induced protein-8 like-2 (TIPE2) upregulates p27 to decrease gastic cancer cell proliferation
25534318 p27kip1 overexpression regulates VEGF expression, cell proliferation and apoptosis in cell culture from eutopic endometrium of women with endometriosis.
25524798 The addition of CDK4/6 inhibitor palbociclib to letrozole in this phase 2 study significantly improved progression-free survival in women with advanced oestrogen receptor-positive and HER2-negative breast cancer.
25490861 Data identi fi ed GDF15 as potential resistance-related factor acting by maintaining a low proliferative and undifferentiated tumor phenotype through upregulation of p27 Kip1 during carboplatin treatment.
25462566 FOXD1 promotes breast cancer proliferation and chemotherapeutic drug resistance by targeting p27
25412309 PKCeta promotes senescence through its ability to upregulate the expression of the cell cycle inhibitors p21Cip1 and p27Kip1 and enhance transcription and secretion of IL-6.
25323759 Data suggest that down-regulation of P27KIP1/CDKN1B in tumor tissue and lymph nodes can be used as tumor marker in patients with metastatic laryngeal squamous cell carcinoma.
25310086 The cell cycleassociated proteins cyclin E and p27kip1 may have contributed to this antitumor effect.
25293778 BCR-ABL1 kinase-dependent and -independent mechanisms convert p27 from a nuclear tumor suppressor to a cytoplasmic oncogene.
25228008 Data show that the signals of cytoplasmic cyclin-dependent kinase inhibitor 1B (p27) and caspase 8 increased and merged together after gefitinib treatment.
25224768 This study demonstrates that p16 and p27 are prognostic indicators of tumor stage and grade in urothelial carcinoma.
25221953 This supports the notion that synchronous activation of Galectin-3 and HBME-1 occurs in thyroid malignancy and is highly specific for malignancy.
25213837 ETV6 and CDKN1B are mainly affected by small monoallelic deletions, whereas mutations and hypermethylation play a minor role in CK-AML.
25205104 An unexpected role for PCTAIRE1 in regulating p27 stability, mitosis, and tumor growth.
25205053 This review summarizes the functions of p27 while highlighting its emerging roles in leukemia.
25151966 miR-340 controls p27 at both translational and posttranslational levels in non-small cell lung cancer
25143434 SIRT1 is a key regulator of p27 protein levels and SIRT1 inhibition is a viable strategy for NSCLC therapy by means of p27 reactivation
25121353 the increased cell-cycle transition due to p27Kip1 deficiency can synergize with increased expression of growth-promoting signals (e.g. EGFR) to accelerate tumour progression.
25084021 EZH2-mediated p27Kip1 downregulation is associated with the accelerated cell proliferation and malignant step in pancreatic IPMN.
25053875 activation of beta-catenin in pterygium may interact with miR-221, resulting in p27Kip1 gene downregulation that influences pterygium pathogenesis.
25053516 p27 was not a prognostic factor in pancreatic adenocarcinoma
25051361 Data suggest that the combination of high p27 Kip1 and low Myc (c-Myc) is a marker of CLL cells which is mediated by Skp2 protein.
25032860 PFKFB3 promotes cell cycle progression and suppresses apoptosis via Cdk1-mediated phosphorylation of p27.
25003467 Inhibition of proliferation is dependent upon p27Kip1 demonstrating that Brachyury acts to modulate cellular proliferative fate in colorectal cancer cells in a p27Kip1-dependent manner.
24947332 single nucleotide polymorphisms in the cell cycle showed significant risks for oral cancer, the highest risk evident for p27 (rs34329).
24920291 The p27 tumor suppressor gene CDKN1B acts as a disease modifier for the multiple endocrine neoplasia (MEN)1 syndrome associated with MEN1 germline mutations.
24867101 Data suggest that neuregulin receptor degradation protein-1 (Nrtp1) may induce cell-cycle inhibitor p27 nuclear retention to directly inhibit proliferation of colorectal cancer (CRC) cells.
24819502 We report a germline heterozygote frameshift mutation of the CDKN1B gene in a Caucasian woman with a long clinical history of MEN1-like multiple endocrine tumors, along with the finding of the mutation in her son.
24806449 DYRK1A phosphorylated p27(Kip1) on Ser10, resulting in protein stabilization.
24789280 findings suggested altered eIF3a expression closely correlated with p27 status, and the association was of prognostic value for resected NSCLC
24741631 Primary biliary cirrhosis progression is characterized by a FoxO1-independent increase of p27kip1 expression.
24727675 An aberrant microRNA signature in childhood T-cell lymphoblastic lymphoma affecting CDKN1B expression, NOTCH1 and growth factor signaling pathways.
24708177 high STMN1 expression is related to low nuclear p27 expression and high cytoplasmic p27 expression. STMN1 knockdown increased p27 expression.
24671224 High Ser10-phosphorylated p27 expression is associated with hepatocellular carcinoma.
24667864 MicroRNA-200b acts as a stimulant for the proliferation of HTFs by targeting p27/kip1 and RND3.
24656158 The functional importance of Skp2 in cyclic hydrodynamic pressure stimulated human bladder smooth muscle cell proliferation, involving p27 as well as p21 signaling pathway, is reported.
24643689 the p27Kip1 protein mRNA expression level was lower in well differentiated tumor with uncertain malignant potential
24574749 EGF upregulates the mRNA and protein levels of Skp2/Cks1 and p27(kip1) via the PI3K/Akt pathway and direct binding of E2F1 transcription factor with the Skp2 promoter in extrahepatic cholangiocarcinoma cells.
24532476 Mutations in p27 are associated with increased corticotropinoma susceptibility.
24523023 conclude that the cyclin-dependent kinase inhibitor 1B rs2066827 polymorphism might not be a risk factor for breast cancer development
24504262 the cell cycle inhibitor p27KIP1 is involved in ERK1/2-mediated MMP-9 expression via activation of the NF-kappaB binding motif, which leads to the migration and invasion of bladder cancer cells induced by IL-7.
24488669 the existence of different patterns of expression of Pim-3, c-Myc, and p-p27 and their clinicopathologic correlations in adenocarcinomas of the gastric cardia and the distal stomach.
24460254 Low expression of KIP1 is associated with osteosarcoma.
24457952 UCA1 promotes breast tumor growth by suppression of Kip1.
24443386 Presence of high SKP2 plus high pSer10p27 levels in triple-negative breast cancers is associated with aggressive growth.
24427780 Nuclear expression of p27 is a potentially favorable factor in the progression and prognosis of nasopharyngeal carcinoma.
24423924 FOXO1 and p27(Kip1) were direct targets of miR-196a.
24381057 MiR-452 directly targets the 3'-untranslated region of cyclin-dependent kinase inhibitor 1B (CDKN1B).
24337749 Decreased the expression of cell cycle inhibitors p16(ink4a) and p27(kip1).
24336329 Results suggest that MIF4GD is a potential regulator of p27-dependent cell proliferation in HCC.
24336114 S-phase kinase-associated protein 2 knockdown blocks colorectal cancer growth via regulation of both p27 and p16 expression.
24322019 Immunofluorescence expression (IFE) of cell cycle regulators p16ink4a, p21, p27, in association with Ki-67, p53 in cell cultures, obtained from different types of cervical intra-epithelial lesions, was assessed.
24243100 p27(Kip1) acts as a multifunctional protein to control critical steps of neuronal migration through activities that go far beyond cell cycle regulation. [review]
24216315 Decreased p27 expression is a predictive biomarker of an unfavorable prognosis of eyelid sebaceous gland carcinoma.
24185511 We observed frameshift mutations of CDKN1B in 14 of 180 small intestine neuroendocrine tumors(SI-NETs), and detected hemizygous deletions encompassing CDKN1B in 7 out of 50 SI-NETs.
24185120 p27 quantitative expression appeared to provide a complementary valuable predictor with other prognostic variables for risk stratification in FTC patients.
24170542 data suggest that Jab1 plays an important role in CAM-DR, which depends on pSer10-p27(Kip1)-mediated subcellular localization of p27(Kip1)
24141420 These findings support an important role of p27 in Notch1-dependent oncogenic signaling.
24098519 Increased cytoplasmic localization of p27(kip1) up-regulates RhoA during progression of chronic myeloid leukemia.
24078094 This meta-analysis suggests that breast cancer may be associated with CDKN1B gene rs34330 polymorphism, but not rs2066827 polymorphism.
24067984 Kaposi's sarcoma-associated herpesvirus Rta induces cell cycle arrest in G0/G1 phase by stabilizing and promoting nuclear localization of p27kip.
24052415 These observations suggest an intrinsic cooperation between p21 and p27 CKIs in the activation of stress-induced cellular senescence and tumor progression in glandular proliferative lesions
24021283 p27(Kip1) inhibits tissue factor expression
24018641 pSer10p27 and CRM1 play cooperative roles in epithelial ovarian cancer
24008375 Treatment with metformin upregulated the expression of p21CIP and p27KIP, but downregulated cyclin D1 levels, both in vitro and in vivo
23982416 Cyclin-dependent kinase inhibitors, p21 and p27, are upregulated by PXD101 in a sustained fashion in histone deacetylase inhibitor resistant cell lines.
23966119 Single nucleotide polymorphism of p27 Kip1 protein gene is associated with hypertrophic scars in patients with severe burns.
23965337 Propose a receptor-specific function for Notch2 in regulating Jag-1-induced p27(kip1) expression and growth arrest in vascular smooth muscle cells.
23963898 cell cycle related proteins PCNA, Ki67, cyclin D3, p27 and p57 were expressed in both normal and diabetic human term placentas.
23946596 Silencing of the Skp2 gene inhibited proliferation, migration and invasiveness of gallbladder carcinoma by mechanisms dependent on enhanced expression of the p27 protein.
23907123 The p27-Skp2 axis mediates glucocorticoid-induced cell cycle arrest in T-lymphoma cells.
23896637 this studydemonstrated abundant levels of the critical negative cell-cycle regulators, p27(Kip1), its phosphorylated form, p-p27(S10), p18Ink4c, and GSK-3, in beta-cells of both adult human and mouse pancreatic islets, which contribute to maintenance of beta-cell quiescence.
23858559 p27 was correlated with lymph node metastasis, depth of invasion, and proliferative activity of gastric cancer.
23832541 Data indicate there was no statistical significance observed between the immunoexpression of p16, p21, p27, and pRb with nodal metastasis, depth of invasion, and presence of vascular or perineural invasion.
23815208 deficient in endometrial cancer samples
23800691 A review of the main functions of p27 and how it is affected by multiple endocrine neoplasia (MENX)-associated mutations.
23725357 The proteasome beta1 subunit plays a novel role in tumorigenesis by degrading p27Kip1.
23678366 HIV-1 Tat relocalizes cyclin-dependent kinase inhibitor 1B (p27) from nuclear to cytoplasm in neuronal cells
23665265 coding regions of SKP2 and P27 were examined in 200 Chinese women with premature ovarian failure and 200 control volunteers. No plausible pathogenic mutations were detected
23624368 Results showed for the first time that polymorphisms in p27 Val109Gly and in prohibitin 3'UTR C1703T genotypes modulate the risk to melanoma in a high UV index region.
23594796 The interaction between SAP155 and FIR/FIRDeltaexon2 not only integrates cell-cycle progression and c-Myc transcription by modifying P27 and P89 expression.
23584484 miR-194 suppresses metastasis of non-small cell lung cancer through regulating expression of BMP1 and p27kip1
23559091 KDM2A is a H3K4 demethylase that regulates cell proliferation through p15(INK4B) and p27(Kip1) in stem cells from apical papilla.
23555276 This study adds the CDKN1B gene to the short list of genes for which mutations that either create, delete, or severely modify their regulatory uORFs have been associated with human diseases
23553486 MiR-24 directly targets p27(Kip1) and p16(Ink4a) in primary keratinocyte.
23536577 UTF1 transactivates p27 Kip1 expression through binding to the activating transcription factor-2 of the p27 Kip1 promoter in cervical cancer cells.
23440295 p27(Kip1) mRNA correlates with clinical features and the survival probability of neuroblastoma patients.
23438793 The co-expression of p27 and p57 by extravillous cytotrophoblasts and their positive correlation in non-molar gestations may indicate its suppressive role on the proliferation of these cells to provide them the capacity for differentiation and invasion.
23382584 TP53, P21 and P27 positivity correlates with survival outcome in low-stage epithelial ovarian cancer.
23339869 TRIP6 also promotes serum-induced reduction of nuclear p27(KIP1) expression levels.
23312942 Data suggest that the p27(Kip1)-838C>A SNP is associated with lower extremity vein bypass graft patency.
23301842 p27kip1 expression was decreased in esophageal carcinomas with overexpression of CKS1 and/or CKS2.
23230143 Findings revealed a novel function of simultaneous p27 and CDK2 cytoplasmic mislocalization in mediating growth-factor-regulated cell proliferation, migration and invasion.
23221604 A low p27 expression is associated with lymph node metastasis, deep stromal invasion, tumor diameter more than 20 mm, and high GOG score and had a prognostic influence on overall survival in a series of 130 women cervical carcinoma.
23221544 Results show p27Kip1 and cyclin D3 are strongly associated with cellular differentiation, and, for the first time, show that up-regulation of p27Kip1 protects hES cells from inducing differentiation-associated and caspase 3-dependent apoptosis.
23203004 BRAF (V600E) is non-associated with Gal-3 expression, whereas it is associated with cytoplasmatic localization of p27kip1 and higher CK19 expression in papillary thyroid carcinoma.
23184467 Data indicate that the signal transducer and activator of transcription 6 (Stat6) as an important cell differentiation regulatory protein functioning by interacting with Sp1 to activate the p21 and p27 gene promoters in breast cancer cells.
23133524 Gatifloxacin induces S and G2-phase cell cycle arrest in pancreatic cancer cells via p21/p27/p53
23077088 Data indicate that LRP6, BCL2L14, DUSP16, CREBL2, and CDKN1B were involed in centromeric (12p11.21-12p13.2) deletion in ETV6-RUNX1 B-cell precursor acute lymphoblastic leukemia (BCP-ALL).
23077062 The expression of p27(Kip1) was reduced in oligodendrocyte progenitor cells in infant white matter lesions after hypoxia.
23062638 Overexpression of Skp2 might be the mechanism underlying p27(Kip1) over degradation.
23034899 Kip1 polymorphisms are associated with hepatocellular cancer.
23029392 Knocking down Skp2 increased nuclear and cytoplasmic p27 and blocked estrogen-induced degradation of p27.
22995332 Emi1 participates in human hepatocellular carcinoma (HCC) cell proliferation and that progression is controlled by anaphase-promoting complex/cyclosome (APC/C) inhibition, which stabilized Skp2 and enabled p27(kip1) degradation.
22988851 Disorder within p27 mediates transmission of an N-terminal tyrosine phosphorylation signal to a C-terminal threonine phosphorylation, constituting a signalling conduit.
22970236 we showed in the present work that H(2)O(2) scavenging prevents nuclear exportation of p27Kip1, allowing cell cycle arrest, suggesting that cancer cells take advantage of their intrinsic pro-oxidant state to favor cytoplasmic localization of p27Kip1
22908227 serine 123 phosphorylation modulates p21 protein stability and activity by suppressing ubiquitin-independent proteasomal degradation.
22823061 A meta-analysis indicated that the p27V109G polymorphism did not correlate with the overall cancer risk in the general population.
22820506 The p27 inhibits ERalpha transcriptional activity by two independent mechanisms, physical nuclear exclusion of ER alpha, and modulation of the ER alpha transcriptional complex.
22763761 No significant correlation was found between p-27, Cyclin D3, and cyclin E in pediatric Embryonal tumors
22710719 MYC inhibits differentiation by antagonizing the imatinib-mediated upregulation of p27.
22675932 There is a negative relationship between Jab1 and p27kiPl protein in laryngeal squamous cell carcinoma.
22665064 USP37 links REST to the control of p27 stability and cell proliferation.
22650359 Study suggests overexpression of BMPRIB may arrest and induce the differentiation of glioblastoma cells due to upregulation of p21 and p27kip1 and that decreased expression of BMPRIB in glioblastoma cells contributes to glioma tumorigenicity.
22586611 Knockdown of the serine/threonine phosphatase PPM1H confers trastuzumab resistance via reduction in protein levels of the tumor suppressor p27.
22553813 p27 and galectin-3 immunohistochemical results were significantly different between follicular adenomas including those with atypical features and minimally and widely invasive follicular carcinomas with highly statistically significant difference
22511779 p27 is an important target of the tumor-suppressive effects of PP2A and likely an important target of the multitude of cellular oncoproteins that emulate the transforming function of ST.
22492278 Our results suggest that Spy1 may be a possible prognostic indicator in NHLs, and it was correlated with phosphorylation of p27(Kip1) on Thr187
22469187 Data indicate that in arecoline treated oral squamous cell carcinoma cells, elevated levels of p21 and p27 could be downregulated through the reactive oxygen species/mTOR complex 1 (ROS/mTORC1) pathway.
22446332 These results suggested that miR-181b could be induced by TGF-beta1 and promote the growth of hepatic stellate cells by directly targeting p27.
22404445 p27kip1 upregulated by hnRNPC1/2 antagonizes CagA-mediated pathogenesis.
22350412 Jab1/CSN5 negatively regulates p27 and plays a role in the pathogenesis of nasopharyngeal carcinoma.
22343731 Aberrant overexpression of miR-196a and consequent downregulation of p27(kip1) could contribute to gastric carcinogenesis.
22311264 Jab1 overexpression contributes to pathogenesis of oral squamous cell carcinomas by degradating p27 expression.
22296117 FoxM1, p27(kip1) and p21(waf1/cip1) showed distinct immunoreactivity according to histological subtype, which may help in the differential diagnosis of pulmonary neuroendocrine tumours.
22293177 p27 has a role in cytokinesis via the regulation of citron-K activity
22291433 CDKN1B variants may contribute to the development of pituitary adenomas, but their low incidence and lack of clear segregation with affected patients make CDKN1B sequencing unlikely to be of use in routine investigation of FIPA kindreds
22221586 These data question previously reported data supporting the prognostic relevance of both p16 and p27 proteins in early prostate cancer.
22199306 p27KIP1 has a role in node-negative breast cancer, but the interaction with ER and PR is only significant in T1a/b stage
22161326 Data indicate that Sic1 function in analogy to its human counterpart p27(Kip1), whose deregulation leads to failure in timing of kinase activation and, therefore, to cancer.
22158041 data show p27Kip1 can perturb mitosis and suggest it does so by sequestering cyclin F, which prevents its interaction with and subsequent degradation of CP110, resulting in centrosome reduplication, mitotic catastrophe and abrogation of cell proliferation
22158041 This study uncovers Cyclin-F as a novel p27Kip1-interacting protein. A p27Kip1 mutant protein that does not inhibit CDK activity triggers centrosome amplification by antagonizing the cyclin F-mediated degradation of CP110.
22158033 acute RECK expression in colon carcinoma cells results in cell cycle-arrest accompanied by downregulation of a ubiquitin ligase component, S-phase kinase-associated protein 2, and upregulation of its substrate, p27(KIP1).
22134138 Regulation of p27 by Artemis and DDB2 is important for cell cycle progression in normally proliferating cells.
22120635 Gene silencing of endogenous CSN5 by siRNA attenuated the XLGalpha(olf)-mediated down-regulation of P27KIP1, which was also demonstrated to require CDK2.
22110200 Loss of KIP1 in the cytoplasm was found in teratomas and embryonal cell carcinomas.
22094872 Differences in p27/skp-2 expression among Malignant salivary gland tumors subtypes correlated with histogenesis and tumor grade
22036806 Novel oncogenic function of p27Kip1: retention and destabilization of the pro-apoptotic PTEN outside of the nucleus.
22026581 Data show that MEN1 gene is the main target for genetic analysis in Multiple endocrine neoplasia type 1 (MEN1) syndrome, and suggest that in patients without MEN1 gene mutation, CDKN1B or AIP genes should also be tested.
22014979 involvement of JNKs in TM4SF5-mediated p27(Kip1) Ser10 phosphorylation and localization during epithelial-mesenchymal transition.
21981759 High cytoplasmic p27(Kip1) levels in renal cancer tissues are associated with advanced disease and reduced cancer specific survival, whereas low nuclear expression levels appear to be beneficial.
21907315 Transfection of siRNA specific for cMet, the HGF receptor, eliminated the HGF anti-proliferation effect on human bone marrow-derived stem cells and the HGF-mediated increase in p53, p21, and p27.
21885849 Deficient p27 phosphorylation at serine 10 increases macrophage foam cell formation and aggravates atherosclerosis through a proliferation-independent mechanism.
21841827 These results show that H. pylori infection induces AKT/PI3K-mediated phosphorylation of p27 to caucse cytoplasmic p27 translocation in gastric cancer
21840777 Cathepsin B and uPAR downregulation reduced tumor growth and increased p27 nuclear expression in vivo.
21828232 Loss of P27KIP1 is associated with melanoma.
21813412 Inhibition of Src family and Abl kinases with either siRNAs or dasatinib enhances paclitaxel sensitivity of ovarian cancer cells through p27(Kip1)-mediated suppression of Bcl-2 and Cdk1 expression.
21795702 WWP1 markedly inhibited the replicative senescence induced by p27(Kip1) by promoting p27(Kip1) degradation.
21785466 Data suggest that p27KIP1 has a crucial proapoptotic role in malignant mesothelioma (MM) cells treated with SRC inhibitors.
21780161 lack of magnesium may increase p21(Cip1) and p27(Kip1) levels mediated by the decrease in ATP content and the activation of p53, resulting in the suppression of cell cycle progression from G1 to S phase in NRK-52E cells
21762277 The expression of cell proliferation markers cyclin A and p27 are independent prognostic factors in patients with esophageal squamous cell carcinoma.
21715331 HIPK2-mediated regulation of p27(kip1) revealed a contribution to cell motility, rather than to cell proliferation, but only in cells that do not express wild-type p53.
21715330 Incomplete folding upon binding mediates Cdk4/cyclin D complex activation by tyrosine phosphorylation of inhibitor p27 protein.
21637966 p27 expression seems to be more powerful than p21 expression in providing useful prognostic information in colorectal cancer
21575944 Sequencing analysis of the complete coding region of CDKN1B in a panel of premature ovarian failure patients and control subjects reveals a novel mutation potentially related to the phenotype.
21575583 The different LH subdomains, despite their sequence and thermodynamic differences, play similar roles in binding and inhibiting Cdk2/cyclin A.
21552422 target of miR-148a in gastric cancer
21508681 repression of CUGBP1 by siRNA transfection enhanced p27 protein levels and stimulated p27 IRES activity
21478681 p27Kip(1) expression levels are critical for self-renewal and pluripotency in embryonic stem cells, defining a role for p27Kip(1) in controlling an epithelial to mesenchymal transition.
21478095 The expression of p27KIP1 was nearly statistically significant with progression in B-CLL
21464733 Low p16(Ink4a) expression, overexpression of p53, cytoplasmic p27(Kip1), and Cyclin A are predictive markers for shorter overall survival in ovarian carcinomas.
21454826 These findings suggest that polymorphisms of the CDKN1B gene may play a role in endometrial carcinogenesis
21423803 The presence of T198 is fundamental for the regulation of p27 functions.
21423214 Data identify cyclin-dependent kinase (CDK) inhibitor p27(Kip1) as a novel JAK2 substrate.
21422114 CDKN1B is an interesting candidate gene as a potential biomarker for prognostication in acute myeloid leukemia.
21371741 reduced immunostaining of PCNA and Ki67 and increased immunostaining of p27 and p57 in the dexamethasone-induced intrauterine growth restriction placental development compared to control placental development
21355095 Silencing of miR-221 or overexpressing of miR-155 in dendritic cells resulted in p27(kip1) protein increase and dendritic cells apoptosis.
21351264 p27 downregulation is associated with tamoxifen resistance in premenopausal breast cancer.
21338280 high levels of pThr187-p27(Kip1) may predict a worse clinical outcome in patients with aggressive lymphomas.
21310472 Low p27 expression could be associated with malignant transformation of the ovarian epithelium and FIGO stage.
21289244 The identification of germline CDKN1B variants in patients with sporadic presentations provides evidence for CDKN1B as a susceptibility gene in the development of typical parathyroid adenomas.
21278490 p27 down regulation following GSK-3 depletion / inactivation plays a critical role in promoting beta-cell replication.
21264218 ability of USP19 to regulate cell proliferation and p27(Kip1) levels.
21245140 SKP2 is a direct MYC target gene and that MYC-mediated SKP2 induction leads to reduced p27 levels. The results suggest the induction of SKP2 oncogene as a new mechanism for MYC-dependent transformation
21236467 Our results suggest that Pirh2 mediates the degradation of p27(Kip1) and participates in cell proliferation in human hepatocellular carcinoma
21224344 Results show that low levels of CDX2 accelerate colon tumorigenesis by reducing p27Kip1 levels.
21216562 in MCF-7 breast cancer cells, abrogation of phosphorylation of Ser(10) in p27(Kip1)resulted in significant changes in gene expression profiles which mediate cell cycle redistribution, sub-cellular localization.
21182779 Chemical genetics approach to restoring p27Kip1 reveals novel compounds with antiproliferative activity in prostate cancer cells.
21177330 In sporadic medullary thyroid carcinoma, the CDKN1B V109G polymorphism correlates with a more favorable disease progression than the wild-type allele and might be considered a new promising prognostic marker.
21115898 Increased frequency of expression of P27 is associated with hepatitis and hepatocellular carcinoma.
21075101 TNF-alpha not only induced the p27(kip) expression and cell cycle arrest in the G(0)-G(1) phase.
21067268 the major phosphorylation site at Ser10 of p27 played a pivotal role in the migration of malignant glioma cells.
21062737 a Pim-1 inhibitory p27(Kip1) peptide could be developed as an anti-cancer drug against prostate cancer.
21054888 regulation of p16, p21, p27 and c-myc is increased by oridonin, which induces apoptosis and senescence in colorectal cancer cells
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21045237 CDKN1B/p27 aberrations seem to be uncommon in PTCL/NOS pathogenesis.
20980721 The discovery of MEN4 has defined a new role for CDKN1B as a tumor susceptibility gene for multiple endocrine tumors.
20890423 The expression of Cyclin-Dependent Kinase Inhibitor p27 was found inversely linked to which of Tspan-1 and Jab1. (Cyclin-Dependent Kinase Inhibitor p27)
20851109 These results indicated that PP6 and CaMKII regulated apoptosis by controlling the expression level of p27.
20833334 review presents the recent advances in MEN-4 and other multiple endocrine neoplasias and summarises the current knowledge of how P27KIP1 and p18-INK4C may be implicated in endocrine neoplasia [review]
20824794 results extend previous findings of CDKN1B mutations in patients with MEN1-related states and support the hypothesis of a tumor suppressor role for p27 in neuroendocrine cells
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20818424 Rheb controls proliferation of TSC2-deficient cells by a mechanism that involves regulation of AMPK and p27, and that Rheb is a potential target for TSC/LAM therapy.
20818387 PUM1 binding induces a local change in RNA structure that favours association with miR-221 and miR-222, efficient suppression of p27 expression, and rapid entry to the cell cycle
20813693 p27kip1 expression is significantly lower in renal cancer tissues than in normal tissues.
20723295 TGFss1 induces cell cycle arrest and apoptosis in HL-60 cells, while the P27(kip1) expression is up regulated.
20713460 Differences in expression levels of apoptosis- and proliferation-controlling proteins define distinct prognostic subgroups of chronic lymphocytic leukemia and uncover a correlation of levels of CDK4, P27 and P53 proteins with higher hierarchical risk.
20698225 In hepatocellular carcinoma, JAB1 was inversely correlated with p27(kip1).
20683061 CDKN1B polymorphism appears to be a predictive factor for breast cancer and CCND1 polymorphism may be a prognostic biomarker. Larger study groups are needed to fully elucidate the role of CCND1 and CDKN1B polymorphisms in the development and prognosis.
20683061 Observational study of gene-disease association. (HuGE Navigator)
20668328 Hypermethylation does not contribute to P2(KIP1) silencing in gastric cancer in a northern Brazil population.
20661724 The expression of the cyclin-dependent kinase inhibitor p27 is increased with cisplatin resistance in a human gastric cancer cell line.
20647308 Data indicate that the addiction of MYCC-amplified ovarian cancer cells to MYCC differs from the dependence of MYCC non-amplified cancer cells on MYC paralogs, but both are mediated, at least in part, by p27(Kip1).
20631637 Overexpressions of nuclear p27 is associated with non-small cell lung cancer.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20626751 Data show that loss of nuclear p27(kip1) is a frequent event in human RCCs and is a powerful predictor of poor outcome which, in combination with low DG expression, could help to identify high-risk patients with clear cell RCC.
20624000 The ER stress-induced apoptosis is enhanced by miR-221/222 mimics and attenuated by miR-221/222 inhibitors. miR-221/222 promoted-apoptosis under ER stress is associated with p27(Kip1)- and MEK/ERK-mediated cell cycle regulation.
20615757 No novel variations were found in exons encoding for CDKN1B. So the mutations in CDKN1B are not common with premature ovarian failure in Han Chinese women
20615757 Observational study of gene-disease association. (HuGE Navigator)
20608352 Laminarin sulfate can inhibit the proliferation, arrest the cell cycle in the S phase and induce apoptosis of prostate cancer PC-3 cells by increased expressions of PTEN and P27kip1.
20565904 High p27kip1 with perinecrotic HIF-1alpha expression is associated with endometrioid endometrial carcinoma.
20558775 Heparin inhibits pulmonary artery smooth muscle cell proliferation through GEF-H1/RhoA/ROCK/p27 signaling pathway.
20546339 Alteration of the p27(Kip1)-interacting cell-cycle regulators appeared strongly involved in the progression of endometriosis-associated ovarian clear cell carcinogenesis through increasing cell proliferative activity.
20541671 This study showed that how p27 dysregulation might affect neuroendocrine cell function and trigger tumorigenesis.
20541486 The data suggest that H. pylori cagA(+) contributes to p53 alteration and indicate that concomitant gene inactivation, with reduced p27 expression, may be a mechanism in which H. pylori can promote the development and progression of gastric cancer.
20530095 Germline alterations in the CDKN1B gene do not contribute to the higher incidence of extrapituitary neoplasia observed in acromegalic patients nor do they play any role in familial isolated tumors.
20530095 Observational study of gene-disease association. (HuGE Navigator)
20508912 Identification of p27/KIP1 expression level as a candidate biomarker of response to rapalogs therapy in human cancer
20507346 Observational study of gene-disease association. (HuGE Navigator)
20492341 Hypermethylation downregulates Runx3 gene expression and its restoration suppresses gastric epithelial cell growth by inducing p27 and caspase3 in human gastric cancer.
20458559 p21 and p27 were identified as the primary molecular targets of Arsenic trioxide against breast cancer.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20448040 the dynamic nuclear distribution of the B56gamma3 regulatory subunit controls nuclear PP2A activity, which regulates cell cycle controllers, such as p27, to restrain cell cycle progression, and may be responsible for the tumor suppressor function of PP2A
20399237 Data suggest that TM4SF5 accelerates G1/S phase progression with facilitated CDK4/cyclin D1 entry into the nucleus, which might be supported by TM4SF5-mediated actin reorganization through cytosolic p27Kip1 expression and Rho GTPase activity.
20372838 Observed a reduction of Akt signaling proteins in prostate cancer tissue compared to benign controls with significantly lower expression of p27kip1, PTEN and p-Akt.
20193371 The transfer of p21(waf1) and p27(kip1) genes could inhibit the growth of human breast carcinoma cells and the unnormal duplication of centrosomes.
20146005 Data show that miR-221 is important in tumorigenesis of C, possibly by specifically down-regulating p27(Kip1), a cell-cycle inhibitor.
20143334 Pfn1 overexpression results in increased protein stability of p27(kip1) (p27-a major cyclin-dependent kinase inhibitor) and marked elevation in the overall cellular level of p27.
20108172 Phosphorylated p27Kip1 on Thr157 is associated with hepatocellular carcinoma.
20075119 The p27KIP1 polymorphism rs34330 (-79C>T) was identified as a risk factor for developing the follicular variant of papillary thyroid carcinoma.
20075119 Observational study of gene-disease association. (HuGE Navigator)
20074558 perlecan plays an indispensible role in endothelial cell proliferation and acts through a mechanism that involves subcellular localization of p27.
20059402 In gastric cancer, reduced expression of p27(KIP1) was closely linked to H. pylori infection, and was dependent on the more pathogenic strains.
20054616 Data show that upregulation of Spry1 in HUVECs inhibits tube formation and is associated with decreased proliferation and increased expression of p21 and p27.
20011080 These results suggest that PKC(alpha) affects cell cycle progression and proliferation in human RPE cells through the downregulation of p27(kip1).
19959471 Studies present the first evidence demonstrating the role of the AP-1 complex in transcriptional down-regulation of the p27(Kip1) gene following mitogenic stimulation.
19953484 The expression of p27(kip1) was up regulated in cells transfected with miR-221/ and miR-222 in glioblastoma cells.
19952944 Cytoplasmic p27 independently predicts poorer prognosis in ovarian carcinoma
19938192 Macrophage MIF increases the proliferation of gastric cancer cells, induces the expression of cyclin D1 at the transcriptional level and inhibits the expression of p27(Kip1) at the post-transcriptional level via the PI3K/Akt pathway
19924135 alterations of the cell-cycle checkpoint controlling proteins p27(KIP1), p16(INK4a), and RB1 may exert a profound effect in malignant transformation in blastic plasmacytoid dendritic cell neoplasm
19923826 In this study, we evaluated the expression of some proteins involved in cell-cycle control (p53, p27, p21, and cyclin D1),148S
19913121 Observational study of gene-disease association. (HuGE Navigator)
19912438 these data indicate that RPS13 could promote the growth and cell cycle progression of gastric cancer cells at least through inhibiting p27(kip1) expression.
19910837 Results indicate that the p21 polymorphism may contribute to susceptibility to pancreatic cancer, particularly among p27 homozygous wild-type carriers and nonsmokers.
19910837 Observational study of gene-disease association. (HuGE Navigator)
19889619 Skp2 and p27 may be useful prognostic markers in the rituximab era.
19887899 novel aspects of the p27(KIP1) protein, which displays genetically separable tumor suppressing and oncogenic functions.
19860623 increase in CDK6, Cyclin E, p27kip1, and p21waf1 expression, and after 6BIO treatment, the expression of most of these proteins decreased.
19843869 We here report the discovery of a novel damage-responsive pathway, which involves p27(Kip1)
19838216 Data show that SHP-1 knockdown increases p27stability, decreases the CDK6 levels, inducing retinoblastoma protein hypophosphorylation, downregulation of cyclin E and thereby a decrease in the CDK2 activity.
19832036 Upregulated p27kip1 can downregulate survivin expression and inhibit telomerase activity in gastric carcinoma cells.
19819988 analysis of BMP-4 induction of arrest and differentiation of osteoblast-like cells via p21 CIP1 and p27 KIP1 regulation
19817957 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19777788 the quantitative and qualitative (pattern of distribution) evaluation of the expressions of Ki67, P27 and P53 may be helpful in differentiating malignant and premalignant epidermal lesions, particularly in unsatisfactory or fragmented specimens
19738611 Observational study of gene-disease association. (HuGE Navigator)
19734935 Our results suggest that exogenous expression of p27 inhibits the proliferation of PC3 cells through induction of G(1) arrest and apoptosis, and this process correlates with inhibition of the EGFR/PI3K/Akt signalling pathway.
19730150 Data show that Protein levels of tumor suppressor targets of the miRNAs were increased by antisense to miR-21 (PTEN and RECK) and miR-221 (p27).
19727727 All patients of Monoclonal gammopathy of undetermined significance (MGUS) and multiple myeloma (MM)lacked methylation at p27 KIP1 gene.
19724954 In endometrial carcinomas, the inverse topological correlation between Skp2 and p27 was evident in 39/66 (59%) cases.
19723645 Women with high p27 expression had a significantly longer disease-free survival
19698214 Low expression of P27(kip1) and the high expression of cyclin G in patients acute leukemia may have some correlation with genesis and development of the disease.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19667240 Patients with the p27(kip1)-838AA genotype have a decreased risk of in-stent restenosis corresponding with enhanced promoter activity of the -838A allele of this cell-cycle inhibitor, which may explain decreased smooth muscle cell proliferation
19667240 Observational study of gene-disease association. (HuGE Navigator)
19657571 expression of S-phase kinase-associated protein 2 (SKP2) in HL-60/A cells nucleofected by SKP2 siRNA was down-regulated whereas the protein level of P27kip1 was up-regulated
19636294 epithelial ovarian cancer subset with high level of SKP2 and low level of p27Kip1 showed a strong association with proliferative marker Ki167; treatment with bortezomib caused downregulation of SKP2 and accumulation of p27Kip1
19631451 Data demonstrate that the novel anticancer mechanism of hinokitiol involves accumulation of p27, down-regulation of pRb, Skp2, and impairment of Cdk2 function.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19594747 Observational study of gene-disease association. (HuGE Navigator)
19587092 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19584057 reveals a novel regulatory mechanism for p27(Kip1) stability and sheds new light on the biological function of Pin1 as a general regulator of protein stability.
19576211 Inhibition of thromboxan synthase TXS results in the p27-related induction of cell death in lung cancer cells.
19559782 Expression levels of NF-Y target genes changed by CDKN1B correlate with clinical prognosis in multiple neoplasms.
19557642 MG-132 is a potent inducer of apoptosis of PEL cells via downregulation of SKP2 leading to accumulation of p27Kip1, resulting in cell cycle arrest and apoptosis
19556892 cofilin expression and its regulation of p27(kip1) expression is important for the control of G(1) phase progression.
19542220 Mirk, through regulating cyclin D turnover, and the CDK inhibitor p27, as shown by depletion studies, functioned independently and additively to regulate the exit of tumor cells from quiescence.
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19533041 Data indicate that PI3K inhibitor, LY294002, almost completely blocked Lf(Fe(3+))-induced Akt activation, and prevented the cytoplasmic localization of p27(kip1).
19531414 For disease-free survival p27Kip1 might be the most useful prognostic factor [in salivary gland mucoepidermoid carcinoma]
19522032 Data show that a mutant form of p27Kip1 can induce apoptosis in colorectal cancer cells.
19493606 ). Women who had at least one mutated allele presented twofold chances for endometriosis development (OR=1.9; 95% CI, 1.120-3.343).
19493606 Observational study of gene-disease association. (HuGE Navigator)
19474519 Observational study of gene-disease association. (HuGE Navigator)
19473963 ectopic expression of PFKFB3 increased the expression of several key cell cycle proteins, including cyclin-dependent kinase (Cdk)-1, Cdc25C, and cyclin D3 and decreased the expression of the cell cycle inhibitor p27
19470470 Increased motility of cancer cells with PI3K and/or MAPK pathway activation may result partly from RSK1 activation, accumulation of p27T198 in the cytoplasm, p27:RhoA binding, inhibition of RhoA/Rock pathway activation, and loss of actomyosin stability.
19461157 in addition to overexpression of Jab1 and reduced expression of p27(kip1), cytoplasmic localization of Jab1 and p27(kip1) are associated with increased cancer cell proliferation and might be related to the invasiveness of papillary thyroid carcinoma.
19451650 EBV PK enhances p27(Kip1) degradation effectively upon EBV productive replication, contributing to establishment of an S-phase-like cellular environment with high CDK activity
19445020 Pirh2 overexpression may have an important role in the development and maintenance of head and neck squamous cell carcinoma at least partially through p27 degradation
19430707 Results show that overexpression of CDK4, cyclin D1, and Rb proteins, and loss of expression of proteins p16, p27, and p19 were statistically significant in NPC tissues compared with non-cancerous NPE (P<0.05) by real-time RT-PCR and tissue microarray.
19424645 Results suggest that both nuclear and cytosolic p27 can promote cancer cell motility.
19397698 Immortalized cell lines from human gingival mucosal keratinocytes with epithelial mesenchymal transition (EMT) expressed significantly elevated levels of cIAP-1, Bclx and p27(kip) higher than non-EMT cells.
19379560 Apoptosis of APL cells induced by As(2)O(3) may be caused by up-regulating TGF-beta1 and P27(Kip1).
19351827 findings show that thrombin stimulates tumor cell growth by down-regulation of p27(Kip1)
19349901 Overexpression of Jab1 in ECA109 cells decreased p27 levels and induced the translocation of p27 from the nucleus to the cytoplasm.
19304516 The expression of P27(Kip1) in valproic acid-treated HL-60/HT cells was significantly lower but P170 expression significantly higher than that of HL-60 cells and normal mononuclear cells.
19298520 This meta-analysis indicates that reduced p27 is an independent prognostic factor for poor overall and disease-free cancer survival.
19293259 Inactivation of PTEN/p27(kip1) proteins is a specific feature in the progression of endometrial carcinoma in obese patients.
19281796 These results suggest that PARP-1 acts as a corepressor for FOXO1, which could play an important role in proper cell proliferation by regulating p27(Kip1) gene expression.
19276255 Loss of p27 is associated with reduced survival in stage III colon cancer but by itself does not indicate a significant difference in outcome between patients treated IFL or 5-fluorouracil/leucovorin.
19273599 These results identify miR-181a as a regulator of p27 mRNA translation during myeloid cell differentiation.
19266349 Nkx3.1 and p27(KIP1) cooperate in proliferation inhibition and apoptosis induction in human androgen-independent prostate cancer cells.
19263441 Data show that the growth inhibitory effects of the glyceollins appeared to be due to an inhibition of G1/S progression and correlated with an up-regulation of cyclin-dependent kinase inhibitor 1 A and B mRNA and protein levels.
19258477 Observational study of gene-disease association. (HuGE Navigator)
19236751 After treating of NB4 cells with As(2)O(3), P27(Kip1) and endogenous TGF-beta1 mRNA expressions were up-regulated, and cyclin E mRNA expression was down-regulated.
19221487 The elevation of cellular miR181a levels abrogates the 1,25-dihydroxyvitamin D-induced increase in Cyclin-Dependent Kinase Inhibitor p27 at both mRNA and protein levels.
19187271 Elevated intracellular p27(Kip1) level in leukemic lymphocytes of early- and intermediate stage B-CLL patients contributes to rapid progression of the disease and mortality.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19141585 Observational study of gene-disease association. (HuGE Navigator)
19139918 Jab1, as a negative regulator of p27, may be associated with the progression and prognosis of epithelial ovarian tumors.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19123975 The E2 core of Cdc34 provides specificity to p27, and the residues 184-196 are required for possessive ubiquitination by Cdc34.
19112177 HINT1 up-regulates cellular levels of p27(KIP1) by two mechanisms: 1) it inhibits its ubiquitylation by targeting the SCF(SKP2) ubiquitin ligase complex, and 2) it inhibits the phosphorylation of p27(KIP1) by Src via inhibiting Src expression.
19107213 A role for miR-221/222 in prostate carcinoma,with upregulation in patient-derived primary cell lines, and a significant inverse correlation with p27 expression.
19106631 analysis of the internal ribosome entry site within the human p27 Kip1 5'-untranslated region
19096232 These results showed that the expression of cyclin D1, p21 and p27, alone or in combination, are early events in gastric tumorigenesis and may serve as a candidate molecular marker for the early gastric carcinoma.
19093261 MG-123 induces apoptosis and G(1) arrest which is associated with upregulated p27kip1 expression in gastric carcinoma cells.
19088079 miR-221 is transcriptionally induced upon PDGF treatment in primary vSMCs, leading to down-regulation of the targets c-Kit and p27Kip1. Down-regulation of p27Kip1 by miR-221 is critical for PDGF-mediated induction of cell proliferation
19082479 Reduced levels of p27Kip1 are assicuated with colorectal cancer.
19079342 Id-1 is a novel PTEN inhibitor that could activate the Akt pathway and its downstream effectors, the Wnt/TCF pathway and p27(Kip1) phosphorylation
19077036 These results suggest that the p27(Kip1) gene specifically senses deregulated E2F activity through the E2F-like elements to suppress inappropriate cell cycle progression in response to loss of pRb function.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19056892 Data show that Wnt-induced turnover of p27(KIP1) was independent from classical SCF(SKP2)-mediated degradation in both mouse and human cells.
19040567 Proliferation parameters of differentiating cells correlate with the activity and structure of cyclin A/E-CDK2 but not of cyclin D-CDK4/6-p27 complexes.
19038492 p27Kip1 is regulated by serine 276 phosphorylation of the p65 subunit of NF-kappaB
19034576 Low p27(Kip1) expression is associated with lymph node metastasis in intrahepatic cholangiocarcinomas.
19020940 Polymorphisms in the P27KIP1 gene is associated with significantly poorer response to treatment in pancreatic cancer patients.
19010853 Loss of p27 and overexpression of cyclin E play a critical role in the aggressiveness of gastroenteropancreatic neuroendocrine tumors
18987662 forced VEGF overexpression or autocrine VEGF stimulation of VEGFR-2 triggers proliferation and migration/invasion of U-937 leukemic c
18977241 Observational study of gene-disease association. (HuGE Navigator)
18953829 During the proliferation of Jurkat cells the protein expression of p27(kip1) decreased and intranuclear p27(kip1) decreased significantly.
18925698 univariate analysis showed overexpression of cyclin D1 & underexpression of p27 predicted lymph node metastases in papillary thyroid carcinomas; low risk group was cyclin D1 negative & p27 positive; high risk group was cyclin D1 positive & p27 negative
18922157 Low p27Kip1 expression were correlated with larger tumor size and higher stage, as well as tumor necrosis in renal cell carcinoma.
18855981 Antitumor bioactivity of adenovirus-mediated p27mt in colorectal cancer cell line SW480.
18838534 Data show that activation of Myc inhibited p27-mediated erythroid differentiation without affecting p27-mediated proliferation arrest.
18823025 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18822693 Down-regulation of p27(Kip1) is a well-established feature of urothelial carcinoma. Probably, this down-regulation of cyclin-dependent kinase inhibitors supports the proliferation phase of oncogenesis.
18818877 Phosphorylation, half-life, and the nucleo-cytoplasmic traffic of p27 protein were altered by 15d-PGJ2 by mechanisms dependent on PI3K/Akt activity.
18818203 BCL2 and BCL-xL facilitation of G0 quiescence requires BAX, BAK, and p27 phosphorylation by Mirk
18808421 a high level of p27(Kip1) expression is evident from early stages of hepatocarcinogenesis.
18794148 Pin1 is identified as a novel negative FOXO regulator, interconnecting FOXO phosphorylation and monoubiquitination in response to cellular stress to regulate p27(kip1).
18788572 The genotype of p27 V/V may be a potential risk factor for susceptibility to epithelial endometrial cancer.
18788572 Observational study of gene-disease association. (HuGE Navigator)
18781093 p27 promotes cell migration in metastatic HCC cells through the regulation of RhoA activity.
18769118 low-level expression of p27 protein may partially attribute to latent EBV infection in extranodal nasal-type NK cell lymphoma involving EBNA1
18766473 the analysis of p21cip1, p27kip1, and p16INk4a by immunohistochemistry could be useful in the management of patients with papillary thyroid carcinoma
18758183 Observational study of gene-disease association. (HuGE Navigator)
18756055 down-regulated p27 protein expression is the possible underlying mechanism for the growth of uterine leiomyoma and over-expression of p27 induces cell death.
18710949 The present data support a role for p27 in the assembly of D-type cyclin-Cdk complexes and indicate that both cyclin D1-Cdk4-p27 assembly and kinase activation are regulated by p27 phosphorylation.
18710468 Mutations in the CDKN1B and AIP genes are relatively uncommon in MEN1 mutation-negative multiple endocrine neoplasia I syndrome patients.
18710468 Observational study of gene-disease association. (HuGE Navigator)
18708351 MicroRNA-221/222 confers tamoxifen resistance in breast cancer by targeting p27Kip1
18695910 p27kip1 expression is frequently down-regulated in head and neck squamous cell carcinoma.
18694622 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18691549 These data suggest that a p27(Kip1)-driven checkpoint limits progression of prostatic intraepithelial neoplasia to prostate cancer.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18673462 Germline mutations in the CDKN1B gene encoding p27 Kip1 are a rare cause of multiple endocrine neoplasia type 1.
18673462 Observational study of gene-disease association. (HuGE Navigator)
18663445 p27 has a role in salivary cancer
18647205 The difference in expression patterns of p27(KIP1) and p57(KIP2) in proliferating and senescent melanocytes suggests the interplay between these proteins may play a functional role in melanocytic tumorigenesis
18645269 CDKN1B V109G polymorphism may not have a role in prostate cancer among the Taiwanese population
18645269 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18644126 Skp2 and p27Kip1 have roles in resistance to preoperative doxorubicin-based chemotherapy in primary breast cancer
18615582 S10 phosphorylation of p27 mediates all trans retinoic acid induced growth arrest in ovarian carcinoma cell lines.
18604603 Data show that skp2 is a cytoplasmic and nuclear protein, and that there is an inverse correlation of endogenous levels of skp2 with p27 and tuberin in different transformed cells and under different growth conditions.
18604165 cell cycle exit is preceded by p27-dependent inhibition of cyclin A-Cdk1/2, cyclin D1 downregulation and reduced pre-mitotic pRb pocket protein phosphorylation
18598941 Antitumoral activities of argyrin A depend on the prevention of p27(kip1) destruction through a potent inhibition of the proteasome.
18593937 Activation of protein kinase G Increases the expression of p21CIP1, p27KIP1, and histidine triad protein 1 through Sp1.
18593906 Pim kinases promote cell cycle progression and tumorigenesis by down-regulating p27(Kip1) expression at both transcriptional and posttranslational levels.
18593906 Pim kinases directly phsophorylate p27Kip1 at threonine-157 and threonine-198 residues.
18583941 Simultaneous knock-down of both p21 and p27 significantly enhanced doubling time, clonogenicity and cell cycle progression in a prostate cancer cell line.
18568767 Show that p27KIP1 was up-regulated in topotecan-induced apoptosis in HepG2 cells.
18543099 common CDKN1B polymorphisms do not markedly modify breast cancer risk among BRCA1 or BRCA2 carriers
18543099 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18521080 miR-221 has an oncogenic function in hepatocarcinogenesis by targeting CDKN1B/p27 and CDKN1C/p57, hence promoting proliferation by controlling cell-cycle inhibitors.
18514141 The expression of Skp2 and p27 proteins in 48 cases of Extranodal nasal-type natural killer cell lymphoma was studied and their correlations with Epstein-Barr virus status and clinical outcomes, was evaluated.
18507837 Observational study of gene-disease association. (HuGE Navigator)
18476592 Expression of p27(kip1) is regulated by Jab1 in lymphoma cell lines.
18459109 Observational study of gene-disease association. (HuGE Navigator)
18437054 tetrandrine induces G(1) arrest and apoptosis through PI3K/kip1/AKT/GSK3beta pathway
18425369 PTEN and p27Kip1 are not downregulated in the majority of renal cell carcinomas
18415709 The low to high grade dedifferentiation of prostate adenocarcinoma is accompanied with the down-regulation of p27(kip1) protein, which may be an important molecular sign of the lost cell cycle control.
18408738 Results suggest that GSK-3 regulates nuclear p27 Kip1 expression through downregulation of Skp2 expression and regulates p27 Kip1 assembly with CDK2, playing a critical role in the G0/G1 arrest associated with intestinal cell differentiation.
18393360 The inhibition of FOXO3a-mediated activation of the p27 gene by the high aberrant expression of c-Myc in many tumor cells likely contributes to their uncontrolled proliferation and invasive phenotype.
18385518 These results identify p66Shc and FOXO3a as novel partners of beta(1)Pix and represent the first direct evidence of beta(1)Pix in cell proliferation via Erk/p66Shc-dependent and Akt-independent mechanisms.
18363870 positive correlation between Foxo3a and p27(kip1)expression in non-Hodgkin's lymphomas
18350604 Review of molecular mechanisms underlying the functional loss of cyclindependent kinase inhibitors p16 and p27 in hepatocellular carcinoma.
18346358 expression of P27KIP1 in human hepatocellular carcinoma
18334933 p16(INK4a), p21(WAF1/CIP1), p27(KIP1), and p53 are expressed in human corneal endothelial cells despite donor ages.
18334837 Large-scale analysis of cell cycle regulators in urothelial bladder cancer identifies p16 and p27 as potentially useful prognostic markers
18327303 tumor cell incubation with pioglitazone results in increased levels of p53 and p27 and decreased levels of cyclin D1
18321488 P27Kip1 is down-regulated in the endometrium of women with endometriosis.
18305109 hCaMKIINalpha suppresses tumor growth by inducing cell cycle arrest via p27 stabilization
18301453 Only FIGO stage, cyclin D1, p27 (Kip1) and Ki-67 are independent prognostic factors that might help in predicting outcome of cervical cancer patients.
18288099 The absence of clonal inactivating mutations suggests that CDKN1B is not a classical tumor-suppressor gene in secondary/tertiary parathyroid tumors
18285702 Jab1 protein may contribute to the tumor progression through Jab1-mediated p27kip1 degradation and that control of Jab1 expression is a novel therapeutic target in hon-Hodgkin's lymphoma.
18281541 Observational study of gene-disease association. (HuGE Navigator)
18281517 Diindolylmethane modulates p27(kip) through transcription, prolongation of protein half-life, and nuclear localization.
18272788 the formation of adherens junctions in hepatocytes requires Ser-10 in p27
18246793 During the proliferation process of lymphoma U937 cells, Jab1 and CRM1 may influence the location and expression of p27kip1.
18226337 Overexpressions of survivin mRNA and p27 protein and reduced expression of PTEN protein might be valuable markers to predict the presence of hepatocellular carcinoma.
18222429 Cleavage-stage human embryos exhibiting developmental arrest show increased p27 mRNA expression.
18203777 expression of p27 was similar in both Small-cell neuroendocrine carcinoma of the uterine cervix and squamous cell carcinoma
18202760 D-allose, a simple monosaccharide, may act to cause TXNIP induction and p27kip1 protein stabilization in tumor cells
18181833 We immunohistochemically analyzed the expression of p21, p27, p14, p16, p53 and proliferation marker Ki67, in 67 low and high grade astrocytic tumors
18180298 alternatively spliced cyclin D1 modulates p27KIP1 binding and cell migration
18177895 Study shows that the 100-residue p27 C-terminal domain is extended and flexible when p27 is bound to Cdk2/cyclin A; this intrinsic flexibility of p27 provides a molecular basis for the signal transduction that regulates p27 degradation and cell division.
18174243 Observational study of gene-disease association. (HuGE Navigator)
18156402 The expression of p21(WAF1/Cip1) and p27(Kip1) was increased at both protein and mRNA levels by hydroxytyrosol, a main phenol of olive oil.
18154709 Equally a tumor suppressor and an additional predisposing system for tumorigenesis.
18095123 Our results suggest p27 as a predictor of prognosis in patients with primary central nervous system lymphoma
18089324 Decreased p27kip1 expression in podocytes suggested a significant role in proteinuria among renal transplant recipients.
18073348 data strongly implicate CDKN1B haploinsufficiency in the pathogenesis of T-cell prolymphocytic leukemia.
18037997 activation of PKCtheta inhibits the FOXO3a/ERalpha/p27(Kip1) axis that normally maintains an epithelial cell phenotype and induces c-Rel target genes, thereby promoting proliferation, survival, and more invasive breast cancer.
18036045 A study evaluating the overexpression of p27(kip1) in urinary bladder urothelial carcinoma is reported; some urothelial carcinomas may tolerate this inhibitor of cell cycle progression.
18032931 Human thyroid carcinomas positive for MAP kinase, have high p27 degradative activity and low levels of p27 protein.
18027257 The CDKIs p16 and p27 are associated with tumour progression in melanoma, but do not reliably predict recurrence or survival.
18006823 Pirh2 acts as a negative regulator of p27(Kip1) function by promoting ubiquitin-dependent proteasomal degradation
17974156 present work reported that hepatic tissue expression of p27 both at mRNA and protein levels was significantly decreased in hepatocellular carcinoma group compared to other groups
17974037 Our study suggests that moderate hypoxia induces HPASMC proliferation, which is partially dependent of p27kip1 down-regulation probably via the induction of growth factors such inhibits both cell proliferation and p27kip1 mRNA degradation.
17927588 p27(Kip1) down-regulation seem to be early events in Fallopian tube carcinogenesis.
17914108 miR-221 and miR-222 are endogenous regulators of p27(Kip1) protein expression, and thereby, the cell cycle.
17908995 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17854759 caspase-like activity is implicated in the turnover of the mammalian cell cycle regulator p27(KIP1).
17851288 p27(Kip1) protein expression in tumor,invasive front and peritumoral tissues in patients diagnosed with renal cell carcinoma affects their long term survival
17804714 p27 plays an essential role in restriction of breast cancer progression.
17803708 Expression of p15, p18 and p27 was not generally related to the MEN1 gene mutational status of the investigated 18 pancreatic endocrine tumours.
17721077 Data show that p27(Kip1) is a direct target for microRNAs 221 and 222, and suggest a role for these microRNAs in promoting the aggressive growth of glioblastoma.
17710155 data suggest that p27 and p18 are unlikely to present classic tumor-suppressor genes in sporadic pancreatic endocrine tumors
17695524 Aberrations of the p53, Rb and p27 pathways are associated with aggressive clinical behavior in DLBCL.
17692879 The apoptogenic activity of BM-ANF1 was mediated through p53 tumor-suppressor gene expression followed by the expression of p21(Cip1) and p27(Kip1)linking it with cell cycle arrest at G1 phase in cancer cells.
17685465 Down-regulation of p27 Kip1 in papillary carcinoma of the thyroid may facilitate tumor cell growtn and disease progression.
17671428 Spy1 expression enhances CDK2-dependent p27 degradation during late G1 and throughout S-phase
17651785 We conclude that Jab1 expression may lead to down-regulation of the negative cell cycle regulator p27(Kip1), pointing to a possible mechanism that promotes hepatocarcinogenesis.
17627278 inhibition of p27(Kip1) expression deregulates expresion of miR-221 and 222 which promotes cancer growth
17613551 present study reviews the current state of knowledge regarding the genes associated to inherited pituitary neoplasia, with a particular focus on the novel pituitary adenoma predisposing genes, CDKN1B and AIP [review]
17611557 p27 could be transformed from a native CDKI into a dynamic oncoprotein at the expense of its extranuclear localization in leukemic cells. Review.
17601350 Observational study of gene-disease association. (HuGE Navigator)
17586698 These results demonstrate that p27 is regulated by neutrophil elastase (NE) and is critical for NE-induced cell cycle arrest.
17581405 Low p27 protein expression is correlated with large tumor size, depth of invasion in squamous lesions, high stage, and poor survival in uterine cervix neoplasms.
17567920 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17567920 No evidence is found to suggest that p27-Val109Gly alone or in combination with cMyc-Asp11Ser is associated with breast cancer survival.
17560996 Data suggest that the aberrantly high Notch1 signaling in T-ALL maintains SKP2 at a high level and reduces p27Kip1, leading to more rapid cell cycle progression.
17554557 pheochromocytomas display extreme reduction/loss of p27Kip1 expression at high frequency
17553787 p15(INK4b), rather than p27(KIP1), is the cyclin-dependent kinase inhibitor responsible for G0/G1 arrest of human melanoma cells grown on fibrillar collagen
17550142 Observational study of gene-disease association. (HuGE Navigator)
17550142 the G allele genotype was significantly associated with lymph node metastases of breast cancer but no significant correlation was noted between G allele genotype and breast cancer risk
17519308 germline CDKN1B/p27(Kip1) mutations predispose to a human multiple endocrine neoplasia type 1-like condition
17502456 adhesion of mantle cell lymphoma and other non-Hodgkin lymphoma cells to bone marrow stromal cells resulted in a reversible G(1) arrest associated with elevated p27(Kip1) and p21 (WAF1) proteins
17470459 p27 localization during the mammalian cell cycle is under the control of the tumor suppressor tuberin
17464290 Myc targets CKS1 to provoke the suppression of KIP1.
17448572 The findings presented here suggest that Ca(2+)/CaM-dependent overactivation of PI3K/Akt signaling cascade in AD cells, plays an important role in regulating p27 abundance by increasing its degradation in the ubiquitin-proteasome pathway.
17409409 Observational study of gene-disease association. (HuGE Navigator)
17407140 integrin beta1 has a role in inhibiting cell proliferation by preventing the Skp2-dependent degradation of p27(Kip1) via PI3K pathway
17404436 Down-regulation of p27(Kip 1) CDKI in prostate cancer is detected in epithelial, vascular and ductal, but not the stromal cells. The intensity of the expression in these cells is associated with tumor stage and grades.
17404431 Intensity of p27(Kip 1) gene expression in renal cell carcinoma is associated with clinical parameters: tumour size, stage, grade and disease presentation. Loss of p27 expression is a risk-factor for renal cell carcinoma disease progression.
17372254 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17357515 p27 was significantly associated with outcome and disease-free survival in primary tumor laryngeal carcinoma.
17319789 Decreased expression of protein p27 Kip1 is related the c-myc amplification and is associated with prostate cancer
17316413 There was a highly significant positive association between p27(KIP-1) and estrogen receptor/progesterone receptor (ER/PR) status and with p27(KIP-1) and cyclin D1 expression in patients with DCIS
17311291 A study evaluting the mechanism of differentiation in HT-29 cells, including the role of p27KIP1, is reproted.
17303695 CKS1B influences myeloma cell growth and survival through SKP2- and p27(Kip1)-dependent and -independent mechanisms
17285761 Analysis of p27 and Ki-67 expression levels might indicate that low proliferating activity of desmoid fibroblasts is connected with another mechanism than the one, in which p27 takes part.
17254967 Phosphorylation by Src impairs the Cdk2 inhibitory action of p27 and reduces its steady-state binding to cyclin E-Cdk2 to facilitate cyclin E-Cdk2-dependent p27 proteolysis.
17254966 This direct link between transforming tyrosine kinases and p27 may provide an explanation for Cdk kinase activities observed in p27 complexes and for premature p27 elimination in cells that have been transformed by activated tyrosine kinases.
17239930 cytoplasmic p27 expression is inversely associated with microsatellite instability-high & CpG island methylator phenotype-high, especially in p53-negative tumors; suggests interplay of functional loss of p27 & p53 in colorectal cancer development
17237771 Phosphorylation of p27 at Thr 198 stabilizes p27 and permits cells to survive growth factor withdrawal and metabolic stress through autophagy. This may contribute to tumour-cell survival under such conditions.
17216128 Results suggest that WDR6 is implicated in the cell growth inhibitory pathway of LKB1 via regulation of p27(Kip1).
17203174 p21 and p27 in carcinoma of oral cavity have roles in progression of squamous cell carcinomas
17188136 p53 and Ki-67 were expressed with increasing frequency, and bcl-2, p21, and mdm-2 with decreasing frequency in thyroid carcinoma progression. p27 and cyclin D1 were expressed in <15% of cases, with a trend toward decreasing expression.
17178856 Reduced expression of the cyclin-dependent kinase inhibitor p27(Kip1) is associated with increased tumor malignancy and poor prognosis in individuals with various types of cancer
17148774 Low p27 expression appears to be associated with poor prognosis, especially among patients with steroid receptor-positive breast tumors.
17123889 altered expression of p27 may be part of the genetic pathway involving microsatellite instability, which is responsible for the development of some colorectal cancers
17072952 We identified a significant correlation between expression of cytoplasmic p27(kip1) and longer disease-specific survival times.
17072949 p27 is widely expressed in gastric well differentiated endocrine tumors (GWDETs), while p21 expression is sparse and observed in two thirds of the cases. Loss of p21 and p27 expressions may be correlated with different carcinoid tumor subtypes.
17053782 Phosphorylation of p27 at T198 prevents ubiquitin-dependent degradation of free p27
17030811 Data demonstrate that germ-line mutations in p27(Kip1) can predispose to the development of multiple endocrine tumors in both rats and humans.
17013388 p27Kip1 is required during induction of T cell tolerance.
17008550 Observational study of gene-disease association. (HuGE Navigator)
17008550 The variable expression levels of cell-cycle inhibitor genes CDKN2A, CDKN2B, and CDKN1B due to regulatory polymorphisms could indeed influence the risk of childhood pre-B ALL and contribute to carcinogenesis.
16966613 Results describe a previously unrecognized, SCFskp2-independent role for the control of p27 mRNA abundance in the development of non-small cell lung cancers.
16951171 When 10% was used as a cutoff for p27 positivity, p27 was expressed in 11 of tumors; however, p27 expression was localized in the nuclei of tumor cells in only 4 of the samples.
16939421 HBx mutant that did not interact with cyclin E/A failed to destabilize p27(Kip1) or deregulate the cell cycle.
16880511 These data suggest a key role for Ro52 RING finger protein in the regulation of p27 degradation and S-phase progression in mammalian cells.
16842750 expression of the p27(Kip1) double-mutant abolishes its cytoplasmic redistribution but does not abrogate G(0/1) phase arrest in the HepG(2) cell line
16835890 Expression of AR protein in PC3-Lenti-AR cells resulted in transactivation of p21 and growth inhibition in culture and in mouse xenografts. Such inhibition was due to induced G1 arrest as documented by expression changes in p27 and p45(SKP2) proteins.
16804901 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16804901 Possible involvement of CDKN1A and CDKN1B variants in the etiology of breast cancer.
16705171 These data demonstrate a critical role for FAK in the regulation of cyclin-dependent kinase inhibitors (CDKIs) through two independent mechanisms: Skp2 dependent and Skp2 independent.
16636894 Low expression for p27 is associated with breast cancer
16598766 Transfection of the pRb-defective SaOs-2 cells with the p27kip1 gene increases their susceptibility to paclitaxel-induced apoptosis. This promoting effect makes p27kip1 interesting tools for therapy in patients with pRb-defective cancers.
16554660 HIV-1 Tat relocalizes cyclin-dependent kinase inhibitor 1B (p27) from nuclear to cytoplasm in neuronal cells
16532026 14-3-3sigma stabilizes p27 Kip1 by inhibiting the activity of PKB/Akt
16526056 Mutations in the 3' untranslated region of Kip1 could provide an additional tool for risk classification in childhood leukemia.
16480585 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16474380 Expression of p27Kip1 is downregulated while oxidative DNA damage increases from early non-neoplastic epithelial alterations through vulvar intraepithelial neoplasias to invasive vulvar carcinomas.
16465393 These results suggest that p27(KIP1) interacts with cdc2 in the M-phase of human retinoblastoma cells.
16463785 Expression of Skp2 was increased and it may lead to decreased p27kip1 level in the hypertrophic scar and keloid.
16458085 These data indicate that p27-KID, which is intrinsically disordered in solution, acts as a thermodynamic tether when bound within the ternary complexes.
16425372 Data suggest that PTEN may regulate the expression of p27 by negatively regulating S phase kinase-associated protein 2 expression.
16407831 TIMP-1-mediates cell-cycle arrest via cyclin D1 downregulation & p27KIP1 upregulation.
16398674 It is considered that tumorigenesis with UC-associated dysplasia is of the bottom-up type, related to altered expression of cyclin A and p27(Kip1).
16391524 These results suggest that the Bis induced growth inhibition of HL-60 cells promotes G0/G1 phase arrest via up-regulation of p27, which seems to be a prerequisite for differentiation.
16365885 Modified p27 expression, mutated at threonine-187 or deleted at the p27-associated protein JAB1 binding domain, reduces tumorigenicity of erbB-2 overexpressing cells in nude mice.
16322693 Loss of CUL4B causes the accumulation of cyclin E without a concomitant increase of p27
16300740 Jab1 promotes cell growth by decreasing p27 level p8-dependently.
16289477 p27Kip1 binds the conserved minichromosome maintenance domain of MCM7 proteins in a growth factor-dependent manner, such that the carboxyl terminal domain of p27Kip1 inhibits DNA replication independent of its function as a cyclin-dependent kinase
16283443 Aggressive acoustic neuromas show postoperative rapid growth and a decreased association with p27 expression.
16273250 Expression of p27 was associated with better overall survival.
16254341 Tax1 induced transcriptional upregula inhibitors p21(cip1/waf1) (p21) and p27(kip1) (p27), and marked suppression of hematopoiesis in immature CD34 cells.
16194892 loss of phosphatase and tensin homolog is more frequent in anaplastic large cell lymphoma as compared to other mature T-/NK-cell lymphomas, which strongly correlates with the loss of p27 expression
16191374 The genesis and invasion of ameloblastoma is associated with the cell proliferation and differentiation, and regulated by the higher expression of cyclin E and the lower expression of p21(WAF1) and p27(KIP1).
16135812 p27 is mislocalized in cytoplasm by oneractivated N-Ras61K via the Ral-GEF pathway.
16123592 although a Cdc34 mutant bearing a deletion of the C-terminal 36 amino acids (Cdc34 1-200) was efficiently charged with ubiquitin by E1, it was severely reduced for the ability to ubiquitinate p27(Kip1) in vitro compared to wildtype Cdc34
16097446 p27(kip1) and Ki-67 have roles in post-surgical disease progression of prostate cancer
16086840 p27 may play a role in the prevention of differentiation of pancreatic cancer
16052694 The reduction or loss of p27 protein and p27mRNA are potentially involved in hepatocarcinogenesis; hypermethylation of p27 might lead to the loss of p27mRNA transcription
16035731 The codon 109 B allele of CDKN1B is associated with high-grade breast tumors.
16024059 study demonstrated the existence of a subtype of high-grade, negative estrogen receptor breast carcinomas with high S-phase kinase-associated protein Skp2 and low cdk-inhibitor p27 levels
16023837 p27 plays a role in terminal neuronal differentiation of human EC cells, but not in their initial commitment to differentiation
16022660 p27(kip1) protein downregulation is usually achieved by proteasomal degradation and is often correlated to a worse prognosis in several types of human cancers.
16019539 analysis of natural killer cell lymphoma/leukemia with homozygous loss of p27/kip1
16012758 T187-phospho-p27(KIP1) was correlated with M phase of the cell cycle in retinoblastoma.
16006622 The 5'-UTR sequence of human p27 does not have internal ribosome entry site activities but contains promoters which may be involved in regulating p27 expression.
15996662 analysis of a p27Kip1 mutant that causes growth arrest and apoptosis in breast cancer cells
15963850 N-Ras(L61) transformed cells lack a G0-G1 arrest upon TGF-beta treatment due to absence of p27. which is degraded through an SKP2-dependent pathwawy.
15936816 The Cyclin-Dependent Kinase Inhibitor p27 plays key roles in cell cycle regulation, and was methylation-negative in myeloid neoplasia.
15924242 Results indicate that p27 serves as a regulator of drug resistance in ovarian tumors. ASON-mediated alteration of p27 reverses resistance of ovarian cancer to anticancer agents.
15890360 p21 and p27, related cyclin-dependent kinase (Cdk) inhibitors, select their cell cycle regulatory Cdk
15833859 Results suggest that BCR-ABL regulates cell cycle in CML cells at least in part by inducing proteasome-mediated degradation of the cell cycle inhibitor p27(Kip1) and provide a rationale for the use of inhibitors of the proteasome BCR-ABL leukemias.
15813917 Inacativaton of this cell cycle regulatory genes by DNA methylation could be associated with tumorigenesis in NK cell disorders.
15798096 FOXO3a expression and reduced p27KIP1 promoter transactivation are seen in the progression of LNCaP human prostate cancer cells to androgen independence
15777850 levels of cyclins and p27(Kip1) CDK inhibitor in hepatoma cells replated on fibronectin are regulated by TGF-beta1-mediated activations of c-Src and Rac1
15746092 Ectopic expression of p27(Kip1) arrested cell proliferation, inhibited Cdk2 and Cdk4 activities, suppressed retinoblastoma phosphorylation and blocked the G(1)/S-phase transition.
15743786 the PI3/AKT pathway and its effector p27(kip1) play major roles in thyroid carcinogenesis
15736055 expression of Skp2, p27KIP1 and Ki-67 in 10 naevi, 15 superficial spreading melanomas, 10 nodular melanomas and 14 melanoma metastases
15722793 P27KIP1 expression appears not to be predictive in poor survival outcome in patients with stage II or III colorectal cancer.
15718252 Altered response to contact inhibition exhibited by thyroid anaplastic cancer cells is due to the failure to upregulate p27(Kip1) in response to cell-cell interactions.
15713665 induction of p27 acts as a negative feedback mechanism for E2F1 and may also contribute to other functions of E2F1
15710386 p27Kip1 inhibits hTERT mRNA expression and telomerase activity through post-transcriptional up-regulation by IFN-gamma/IRF-1 signaling
15708847 low molecular weight forms of cyclin E may contribute to tumorigenesis through their resistance to the inhibitory activities of p21 and p27 while sequestering these CKIs from the full-length cyclin E
15701850 High Cytoplasmic localization of p27(kip1) is associated with late-stage ovarian carcinomas
15688030 FOXO4A3 also can regulate p27 post-transcriptionally.
15688004 p27Kip1 is upregulated by cycl AM when transfected into mouse cells.
15652359 antisense oligonucleotides targeting the human ubiquitin-conjugating enzyme Cdc34 downregulate its expression, inhibit the degradation of p27Kip1, and prevent cellular proliferation
15647380 p27Kip1 has a role in the decision of myoblasts to commit to terminal differentiation, distinct from the regulation of cell proliferation
15645120 differentiation-inducing agents, particularly sodium butyrate, suppress growth of oral squamous carcinoma cells through apoptosis and induce cell differentiation possibly through mechanisms involving COX-2, p27Kip1 and/or p21WAF1/Cip1 in vitro and in vivo
15627896 Observational study of gene-disease association. (HuGE Navigator)
15611642 The targets and pathways affected by trastuzumab work in concert to maximize the expression and inhibitory effect of p27Kip1, which leads to cell cycle G1 arrest and growth inhibition.
15605273 Downregulation of both Skp2 and p27 increased apoptosis synergistically
15592362 The cytoplasmic localization of p27,Kip1 may be the molecular mechanism whereby breast cancer cells circumvent TNF-alpha-induced growth inhibition and apoptosis.
15583032 Physiologic coupling of osteoblast differentiation to cell cycle withdrawal is mediated through runx2 and p27KIP1, and these processes are disrupted in osteosarcoma.
15579505 OxLDL has a dual effect on cell-cycle progression via regulation of p27(Kip1) expression, resulting in cellular proliferation and hypertrophy, involving activation of RhoA.
15579463 Thr-157 phosphorylation inhibits the association of p27 with importin alpha thus preventing its re-entry into the nucleus
15492811 up-regulation of p27 and down-regulation of MAPK proteins were involved in atRA-induced apoptosis and cell cycle arrest in melanoma
15480426 Trx may regulate cell cycle and growth through a novel modulation of AP-1 activity and p27Kip1 degradation with Jab1
15475071 In contrast to some hematological malignancies p27KIP1 methylation does not appear to contribute significantly to T-LBL/ALL pathogenesis.
15457580 Defect of spindle checkpoint gene Mad2 and mutation of p27 gene are involved mainly in colorectal carcinogenesis
15378017 demonstrate genetically the oncogenic cooperation between defects on INK4a/ARF and p27, which are common alterations in human cancer
15374880 Akt activation promotes cell cycle progression through inactivation of p27 in anaplastic large cell lymphoma.
15358549 sequence requirement for N-terminal cleavage and the proteasomal degradation of p27Kip1 and their relationship was investigated
15355997 p27 binds to tuberin and is regulated by SCFSkp2
15352609 The ad-p27wt induced cell cycle arrest at the G1-S transition point, whereas the ad-p27mt induced arrest at the G2-M point. Both ad-p27wt and ad-p27mt induced a growth-inhibiting effect, apoptosis, and suppression of in vitro tumorigenicity.
15314639 Down Regulation of P27KIP1 is associated with benign prostatic hyperplasia
15289327 Cytoplasmic mislocalization of p27Kip1 protein is associated with constitutive phosphorylation of Akt resulting in acute myelogenous leukemia
15271792 v-cyclin and p27(KIP1) stably associate in primary effusion lymphoma cells
15239677 hypoxia-mediated cell-cycle arrest may be mediated by p27 up-regulation
15217930 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15217930 the V109G polymorphism of the p27 gene may have a role in progression of oral squamous cell carcinoma
15199159 cyclin A-cdk2 plays an ancillary noncatalytic role in the ubiquitination of p27(KIP1) by the SCF(skp2) complex
15188025 loss of p27 expression is associated with endometrial carcinogenesis
15170516 the role of p27 in at least some differentiation pathways of mES cells is to prevent apoptosis, and it is not involved in slowing cell cycle progression; also the pro-survival function of p27 is realized via regulation of metabolism of D-type cyclin(s).
15161709 VEGF together with pRb2/p130 may have a role in hepatocellular carcinoma in a p27((KIP1))-independent manner
15154004 Low levels of p27 in primary and metastatic melanoma cases may explain the high proliferation rate of such lesions.
15133847 results suggest that p27 underexpressing in patients with hepatocellular carcinoma is closely associated with infiltration, metastasis, and prognosis; alterations in the subcellular localization of p27 protein may occur early during hepatocarcinogenesis
15096506 the Skp2-p27kip1 pathway and the G1/S transition are regulated by RhoA, mDia, and ROCK
15064717 Vitamin d3 receptor is involved in the induction of p27Kip1 by vitamin D3.
15061869 Observational study of gene-disease association. (HuGE Navigator)
15060836 The expression patterns of cyclin D1, cyclin E, p21/waf1 and p27/kip1 in inflammatory bowel disease (IBD) may indicate their contribution in epithelial cell turnover and their possible implication in IBD-related dysplasia-carcinoma.
15057270 The classical bipartite-type basic amino-acid cluster and the two downstream amino acids of the C-terminal region of p27 function as a nuclear localization signal for its full nuclear import activity.
15050687 HIV-1 Tat relocalizes cyclin-dependent kinase inhibitor 1B (p27) from nuclear to cytoplasm in neuronal cells
15034923 p27(KIP1) phosphorylation by CK2 probably involves a docking event mediated by the CK2beta subunit.
15026335 A polymorphism in the CDKN1B gene is associated with increased risk of hereditary prostate cancer
15024385 p27 has nascent secondary structure that may have a function in molecular recognition
15014027 p27(kip-1) is an indicator of poor prognosis in colorectal adenocarcinoma.
14984940 Expression of p27Kip1 is down-regulated while oxidative DNA damage increases during cervical carcinogenesis. Both parameters are altered at early stages of the process and might help to predict patients at high risk of progression.
14871979 p27kip1 has a role in progression of Ewing's family tumors
14760081 p27(Kip1) protein has a role in progression of Wilms' tumor
14747563 regulated by Epstein-Barr virus nuclear antigen 3C (EBNA3c) during primary B cell transformation
14719054 In various human cancers, the reduced p27Kip1 expression correlates well with poor prognosis
14707458 In conclusion, tissue expression of p27 is a significant predictor of 5-year survival in stage I-II pancreatic adenocarcinoma
14707456 Overexpression of Skp2 and Jab1 is associated with the reduction of p27(KIP1) expression, and may have a role in the progression of Oral Squamous Cell Carcinoma.
14694185 p27kip1 protein and mRNA expression were up-regulated in myelocytes/metamyelocytes and reached peak levels in PMNs
14666612 JAB1 contributes to the progression of malignant lymphoma of the thyroid especially with aggressive phenotypes, possibly by degrading p27.
14654548 An inverse correlation between JUN and p27(Kip1) expression levels in breast cancer.
14614018 Loss of p27 expression is associated with endometrial adenocarcinomas
14612944 p27KIP1 has a role in down-regulation of telomerase activity
14606065 Adenovirus-p27kip1 can inhibit the growth and multiplication of esophageal carcinoma cells and induce apoptosis.
14586408 TGF-beta induces apoptosis in normal thyrocytes via p27 reduction.
14573608 p27kip1 is down-regulated during rapamycin-resistant proliferation of CD8+ T cells
14558671 increased p27 degradation through the ubiquitin-proteasome pathway could be regulated in pituitary tumors by changes in Skp2 expression
14534684 p27Kip1 levels are not affected by PTEN protein in the progression of ovarian carcinoma
14517080 stability of p27(Kip1) by hepatitis C virus core is associated with blocking activated T cells for the G(1) to S phase transition and inhibiting T cell proliferation
12963837 cyclin-dependent kinase inhibitor 1B plays dual role in the regulating apoptosis
12954644 Inhibition of Cdk2 by 1,25-(OH)2D3 may involve impairment of cyclin E-Cdk2-dependent p27Kip1 degradation through cytoplasmic mislocalization of Cdk2
12904306 p27Kip1 is downregulated by estrogens in breast cancer cells through Skp2 and through nuclear export mediated by the ERK pathway
12883474 hepatocyte growth factor suppresses HepG2 cell proliferation by directly increasing p27 expression and indirectly decreasing Skp2 expression.
12882323 Neuronal cytoplasmic P27 & phosphorylated p27 increase in Alzheimer's disease. Phosphorylated p27 overlaps with tau-positive neurofibrillary pathology. Dysregulation of the cell cycle plays a crucial role in the pathogenesis of Alzheimer's disease.
12860294 jab1 plays a role in the progression of thyroid carcinomas, especially those of aggressive phenotypes, and it may be responsible for p27 degradation in anaplastic and papillary carcinomas.
12850001 Results suggest that p27(KIP1) contributes to the bone morphogenetic protein-induced growth arrest and neuronal differentiation of neuroblastoma cells.
12824885 Down-regulation of p27kip1 is associated with spindle-cell sarcoma
12820381 The abundance of p27 in oral leukoplakia may inhibit cell proliferation and lead premalignant tumor cells to apoptosis, and thus is concerned with prevention of tumor progression.
12813041 ubiquitination is controlled by negatively charged amino acid in Skp2
12809895 Patients with organ-confined disease but low p27 expression have a greater than fivefold risk of developing prostate-specific antigen recurrence than are men with high p27 expression; p27 may be a molecular marker associated with micrometastatic disease.
12777997 results show that cyclin D2 is complexed with p27, leading to a model for testicular germ cell tumors whereby the overexpression of cyclin D2 leads to the functional sequestration of p27 in the presence of CCNE and CCND2, favoring cell proliferation
12771291 Reduced expression of p21 and p27, being VDR dependent, is major pathogenic factor for nodular parathyroid gland growth in advanced secondary hyperparathyroidism. Review.
12748192 results indicate that protein kinase CKII may control IkappaBalpha and p27Kip1 degradation and thereby G1/S phase transition through the phosphorylation of threonine 10 within CKBBP1 protein
12727815 Observational study of gene-disease association. (HuGE Navigator)
12727815 CDKN1A and CDKN1B variants are associated with advanced prostate cancer.
12700629 Inducible p27(Kip1) expression inhibits proliferation of K562 cells and protects against apoptosis induction by proteasome inhibitors
12698196 Inhibitor shows antitumor effect on glioma cells.
12684618 p27Kip1 may play an important role in the invasion and metastasis of an oral cancer cell involved in regulation of E-cadherin and Tiam-1
12684422 PTEN and p27Kip1 have roles in tumor cell proliferation, and increased risk of recurrence
12682919 The sequences of p27(Kip1R) required for nuclear localization and growth inhibition were determined in HeLa cells using a green fluorescence protein (GFP) as a reporter molecule.
12670508 Skp2 mRNA expression level was high in squamous cell carcinomas of the lung and was inversely related with the p27(Kip1) protein level
12642875 deregulation of control mechanisms at G1/S transition by combination of high cyclin E levels in the absence of p27(Kip1) is sufficient to predispose mice to develop lymphoid malignancies and further support a role of p27(Kip1) as a tumor suppressor
12637327 results show that Ser727/Tyr701-phosphorylated Stat1 plays a key role as a prerequisite for the ATRA-induced down-regulation of c-Myc; cyclins A, B, D2, D3, and E; and simultaneous up-regulation of p27Kip1, associated with arrest in the G0/G1 phase
12599217 CDK2 activity was reduced dose-dependently after 24 h of ZD1839 treatment and this effect correlated with increased amount of p27(KIP1) and p21(CIP1/WAF1) associated with CDK2-cyclin-E and CDK2-cyclin-A complexes in head/neck squamous carcinoma cell lines
12579309 Eight of 22 lymphomas with loss of p27 protein expression showed methylation in CpG island of 5' region of p27 gene. These findings suggested that gene methylation plays a role in loss of expression of p27, which gives the cells proliferative advantages.
12576455 Low expression is an independent adverse prognostic factor in patients with multiple myeloma
12531224 Prolonged adenovirus-mediated expression of p27(Kip1) down-regulates integrin alphav beta5 expression on t(2;5)-anaplastic large cell lymphoma cells.
12529328 in tumor-derived cells, p27(Kip1) could be degraded by calpains through a MAP kinase-dependent process, and abnormal cytoplasmic localization, linked to its phosphorylation state, could be involved in this alternative mechanism of degradation.
12529174 examination of protein-protein interactions involved in the recognition of p27 by E3 ubiquitin ligase
12527941 Down-regulation of p27 is associated with early progression of head & neck squamous cell carcinoma.
12515730 In MCL lines, most p27 protein was sequestered into complexes containing cyclin D1, which renders p27 ineffective as an inhibitor of cellular growth & contributes to lymphomagenesis.
12508646 Low p27 expression in colorectal carcinoma was significantly associated with late Dukes stage, high incidence of lymph metastasis, and distant metastasis, poor prognosis, and short survival time. p27 is an prognostic marker of colorectal carcinoma.
12507555 Review focused on the regulation of p27 proteolysis and its consequences for tumorigenesis.
12490316 A low level of p27 expression was significantly correlated with loco-regional recurrence in nasopharyngeal carcinoma.
12482975 These observations define a novel role for p27 in cell motility that is independent of its function in cell cycle inhibition.
12429629 induction of Skp2 may be causally linked with decreased levels of p27 in prostate cancer and implicate PTEN in the regulation of Skp2 expression
12413889 The results indicate that the cell shape change caused by staurosporine correlates with the accumulation of p27kip1 and that staurosporine interferes with the p27kip1-specific proteolysis activity.
12401804 Data show that PAX3-FKHR-expressing cells had reduced expression of p27(Kip1) protein, a key cell cycle regulator.
12386815 upregulation by Muc4/sialomucin
12356941 This study represents the first demonstration of an increased expression of p27 in cleavage-stage human arrested embryos.
12351407 correlates with expression of Skp2 in malignant lymphoma: correlates with proliferation index
12244303 Data show that cytoplasmic relocalization of p27(kip1), secondary to Akt-mediated phosphorylation, inactivates the growth inhibitory properties of p27(kip1) and sustains the proliferation of breast cancer cells.
12244302 Data show that activation of protein kinase B (PKB)/Akt, contributes to resistance to antiproliferative signals and breast cancer progression in part by impairing the nuclear import and action of p27.
12244301 These data indicate that Akt may contribute to tumor-cell proliferation by phosphorylation and cytosolic retention of p27(kip1), thus relieving CDK2 from p27-induced inhibition.
12239454 Has prognostic value in gastric cancer
12210483 exogenous p27kip1 overexpression results in cell cycle regulation in human prostate carcinoma cells; expression associated with increase in early apoptosis
12202478 P27 is required to maintain TGF-beta mediated G1 arrest in cancer cell line.
12188931 Androgen control of p27 stability in prostate cancer cells is mediated by F-box protein SKP2.
12133571 P27/Kip.1 decreased with anaplasia and was absent in glioblastomas (GBM);Skp2 was absent in well differentiated astrocytomas but was expressed in GBM. Skp2 might denote dividing cells in anaplastic gliomas or be instrumental to p27/Kip.1 degradation.
12133429 function and clinical value of cyclin E and p27 in adult acute leukemia (AL)
12123335 P21Waf1 immunoreactivity is higher in male breast cancers compared with female breast cancers.
12119282 Kip1 inhibits Jab1 mediated c-Jun dependent transcription
12101669 inhibits phosphorylation of retinoblastoma protein and functions as negative control in cell cycle
12093740 p27(Kip1) is phosphorylated on serine 10 and threonine 187 by human kinase interacting stathmin, a nuclear protein that binds the C-terminal domain of p27(Kip1) and phosphorylates S10 in vitro and in vivo, promoting its nuclear export to the cytoplasm.
12086850 reduction in p27 accelerates gastrointestinal tumorigenesis in APC mutant mice, but not in SMAD3 mutant mice
12085261 expression may be an indicator of poor prognosis in adenometroid adenocarcinoma of the uterine corpus
12082635 BRCA1 transactivates p27(Kip1)depending on the presence of a functional C-terminal transactivation domain. Promoter-deletion analysis identified a putative BRCA1-responsive element at position -615 to -511 of the p27(Kip1) promoter.
12082530 P27KIP1 colocalizes with PGP9.5 in the nucleus
12052868 Cell attachment to the extracellular matrix induces proteasomal degradation of p21(CIP1) via Cdc42/Rac1 signaling (P21CIP1)
12051885 Down-regulation of p27 is associated with malignant transformation and aggressive phenotype of cervical neoplasms.
12051866 The combined evaluation of p27Kip1 and Ki-67 expression provides independent information on overall survival of ovarian carcinoma patients.
12042314 Akt promotes cell-cycle progression through the mechanisms of phosphorylation-dependent 14-3-3 binding to p27(Kip1) and cytoplasmic localization.
12015771 High p27 levels detected in a subset of advanced breast carcinomas correlate with lymph node metastasis, suggesting that other mechanisms may bypass the cell cycle inhibitory role of p27 and provide growth advantage in these tumores.
11967155 The COP9 signalosome inhibits p27(kip1) degradation and impedes G1-S phase progression via deneddylation of SCF Cul1.
11957145 primary hepatoblastoma well-differentiated fetal tumors without mitotic activity are strongly p27 positive
11940657 Altered p27(Kip1) phosphorylation, localization, and function in human epithelial cells resistant to transforming growth factor beta-mediated G(1) arrest
11940481 Interleukin-11 induction of proliferation of human T-cells is associated with downregulation of p27(kip1).
11920465 low expression may be significant and independent, unfavorable prognostic factor in renal cell carcinoma
11908736 REVIEW: gene expression regulation and role CDK inhibitor P27 in cell survival and cell cycle control in early hematopoiesis.
11889117 phosphorylation on serine 10 is required for its binding to CRM1 and nuclear export
11884439 p27Kip1 integrates mitogenic MEK kinase- and PI3-kinase-dependent signals from TCR and CD28 to regulate cell cycle progression in primary T lymphocytes.
11877298 Retinoic acid-induced cell cycle arrest of human myeloid cell lines is associated with posttranscriptional up-regulation of p27(Kip1).
11877274 Inhibition of bone marrow stem cell proliferation by retinol was mediated by the up-regulation of cyclin-dependent kinase inhibitors, p21(Cip1) and p27(Kip1).
11875067 Rho activity can alter the translation of p27 mRNA and is important for RasV12-induced transformation in a manner dependent on p27 status

AA Sequence

MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPL      1 - 70
EGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDS     71 - 140
QTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT                141 - 198
//

Text Mined References (790)

PMID Year Title
27035903 2016 HER2+ Cancer Cell Dependence on PI3K vs. MAPK Signaling Axes Is Determined by Expression of EGFR, ERBB3 and CDKN1B.
26940882 2016 Estrogen-related receptor ? is upregulated in liver cancer and its inhibition suppresses liver cancer cell proliferation via induction of p21 and p27.
26911146 2016 Depletion of histone demethylase KDM5B inhibits cell proliferation of hepatocellular carcinoma by regulation of cell cycle checkpoint proteins p15 and p27.
26874904 2016 PKM2 uses control of HuR localization to regulate p27 and cell cycle progression in human glioblastoma cells.
26847530 2016 miR-24 regulates CDKN1B/p27 expression in prostate cancer.
26775844 2016 Salivary protein histatin 3 regulates cell proliferation by enhancing p27(Kip1) and heat shock cognate protein 70 ubiquitination.
26701207 2016 Interferon-?-induced p27KIP1 binds to and targets MYC for proteasome-mediated degradation.
26687548 2015 NSun2 delays replicative senescence by repressing p27 (KIP1) translation and elevating CDK1 translation.
26682002 2016 Histone Deacetylase Inhibitors Increase p27(Kip1) by Affecting Its Ubiquitin-Dependent Degradation through Skp2 Downregulation.
26677902 2015 Induction of cell cycle arrest via the p21, p27-cyclin E,A/Cdk2 pathway in SMMC-7721 hepatoma cells by clioquinol.
26636522 2015 MIR-150 promotes prostate cancer stem cell development via suppressing p27Kip1.
26602816 2015 A Pleiotropic RNA-Binding Protein Controls Distinct Cell Cycle Checkpoints to Drive Resistance of p53-Defective Tumors to Chemotherapy.
26579796 2015 Genetic Association Between CDKN1B rs2066827 Polymorphism and Susceptibility to Cancer.
26528715 2015 MARCKS Signaling Differentially Regulates Vascular Smooth Muscle and Endothelial Cell Proliferation through a KIS-, p27kip1- Dependent Mechanism.
26499333 2015 Eya4 Induces Hypertrophy via Regulation of p27kip1.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26481195 2015 Interaction of Cx43 with Hsc70 regulates G1/S transition through CDK inhibitor p27.
26471266 2015 DLL4/Notch1 and BMP9 Interdependent Signaling Induces Human Endothelial Cell Quiescence via P27KIP1 and Thrombospondin-1.
26391562 2015 Differential somatostatin receptor (SSTR) 1-5 expression and downstream effectors in histologic subtypes of growth hormone pituitary tumors.
26320455 2015 SKP2/P27Kip1 pathway is associated with Advanced Ovarian Cancer in Saudi Patients.
26313918 2015 The novel protective role of P27 in MLN4924-treated gastric cancer cells.
26291312 2015 A novel lncRNA, LUADT1, promotes lung adenocarcinoma proliferation via the epigenetic suppression of p27.
26279144 2015 p27(Kip1) signaling: Transcriptional and post-translational regulation.
26254224 2015 COP1 enhances ubiquitin-mediated degradation of p27Kip1 to promote cancer cell growth.
26223520 2015 Hypoxia inducible prolyl hydroxylase PHD3 maintains carcinoma cell growth by decreasing the stability of p27.
26213845 2015 eIF3a improve cisplatin sensitivity in ovarian cancer by regulating XPC and p27Kip1 translation.
26109559 2015 Keratin-17 Promotes p27KIP1 Nuclear Export and Degradation and Offers Potential Prognostic Utility.
26065650 2015 Recurrent CDKN1B (p27) mutations in hairy cell leukemia.
26053093 2015 Mutant AKT1-E17K is oncogenic in lung epithelial cells.
26044523 2015 miRNA-24-3p promotes cell proliferation and inhibits apoptosis in human breast cancer by targeting p27Kip1.
25970772 2015 The interplay between TEAD4 and KLF5 promotes breast cancer partially through inhibiting the transcription of p27Kip1.
25925673 2015 Statin-induced anti-proliferative effects via cyclin D1 and p27 in a window-of-opportunity breast cancer trial.
25894374 2015 K-Ras promotes the non-small lung cancer cells survival by cooperating with sirtuin 1 and p27 under ROS stimulation.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25851349 2015 Mdig, a lung cancer-associated gene, regulates cell cycle progression through p27(KIP1).
25824098 2015 Prognostic role of the CDNK1B V109G polymorphism in multiple endocrine neoplasia type 1.
25821107 2015 PI3K/AKT pathway-mediated regulation of p27(Kip1) is associated with cell cycle arrest and apoptosis in cervical cancer.
25790540 2015 Clinicopathological importance of Ki-67, p27, and p53 expression in gastric cancer.
25788262 2015 Caffeic acid phenethyl ester induced cell cycle arrest and growth inhibition in androgen-independent prostate cancer cells via regulation of Skp2, p53, p21Cip1 and p27Kip1.
25744729 2015 Validation of p27KIP1 expression levels as a candidate predictive biomarker of response to rapalogs in patient-derived breast tumor xenografts.
25733683 2015 Brk/Protein tyrosine kinase 6 phosphorylates p27KIP1, regulating the activity of cyclin D-cyclin-dependent kinase 4.
25695279 2015 Expression and mutational analysis of Cip/Kip family in early glottic cancer.
25675191 2015 Dysregulation of CDK inhibitors and p53 in HPV-negative endocervical adenocarcinoma.
25666480 2015 Expression of p27 and Jun activation domain-binding protein 1 in endometriosis.
25663461 2015 Immunohistochemically detected expression of Skp2, p27 kip1, and p-p27 (Thr187) in patients with cholangiocarcinoma.
25594310 2016 Rheb promotes cancer cell survival through p27Kip1-dependent activation of autophagy.
25587029 2014 Mislocalization of p27 to the cytoplasm of breast cancer cells confers resistance to anti-HER2 targeted therapy.
25586243 2015 Somatic Mutations and Genetic Heterogeneity at the CDKN1B Locus in Small Intestinal Neuroendocrine Tumors.
25578966 2015 DICER-dependent biogenesis of let-7 miRNAs affects human cell response to DNA damage via targeting p21/p27.
25572801 2015 Inhibition of S-phase kinase-associated protein 2-mediated p27 degradation suppresses tumorigenesis and the progression of hepatocellular carcinoma.
25566967 2015 Fenofibrate induces G0/G1 phase arrest by modulating the PPAR?/FoxO1/p27 kip pathway in human glioblastoma cells.
25536447 2015 Tumor necrosis factor-?-induced protein-8 like-2 (TIPE2) upregulates p27 to decrease gastic cancer cell proliferation.
25534318 2015 p27kip1 overexpression regulates VEGF expression, cell proliferation and apoptosis in cell culture from eutopic endometrium of women with endometriosis.
25524798 2015 The cyclin-dependent kinase 4/6 inhibitor palbociclib in combination with letrozole versus letrozole alone as first-line treatment of oestrogen receptor-positive, HER2-negative, advanced breast cancer (PALOMA-1/TRIO-18): a randomised phase 2 study.
25490861 2015 Knockdown of platinum-induced growth differentiation factor 15 abrogates p27-mediated tumor growth delay in the chemoresistant ovarian cancer model A2780cis.
25462566 2015 FOXD1 promotes breast cancer proliferation and chemotherapeutic drug resistance by targeting p27.
25412309 2014 PKC? promotes senescence induced by oxidative stress and chemotherapy.
25323759 2014 Immunohistochemical expression of p27(kip1) in metastatic laryngeal squamous cell carcinoma.
25310086 2014 14-3-3? functions as an oncogene in SGC7901 gastric cancer cells through involvement of cyclin E and p27kip1.
25293778 2014 BCR-ABL1 promotes leukemia by converting p27 into a cytoplasmic oncoprotein.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25228008 2014 Gefitinib induces cytoplasmic translocation of the CDK inhibitor p27 and its binding to a cleaved intermediate of caspase 8 in non-small cell lung cancer cells.
25224768 2014 Expressions of p16 and p27 in urothelial carcinoma and their prognostic value.
25221953 2015 A Pilot Study of Galectin-3, HBME-1, and p27 Triple Immunostaining Pattern for Diagnosis of Indeterminate Thyroid Nodules in Cytology With Correlation to Histology.
25213837 2014 Haploinsufficiency of ETV6 and CDKN1B in patients with acute myeloid leukemia and complex karyotype.
25205104 2014 PCTAIRE1 phosphorylates p27 and regulates mitosis in cancer cells.
25205053 2015 p27 and leukemia: cell cycle and beyond.
25151966 2015 miR-340 inhibits tumor cell proliferation and induces apoptosis by targeting multiple negative regulators of p27 in non-small cell lung cancer.
25143434 2015 SIRT1 inactivation evokes antitumor activities in NSCLC through the tumor suppressor p27.
25121353 2014 A new tumour suppression mechanism by p27Kip1: EGFR down-regulation mediated by JNK/c-Jun pathway inhibition.
25084021 2014 EZH2 is associated with malignant behavior in pancreatic IPMN via p27Kip1 downregulation.
25053875 2014 MiRNA-221 negatively regulated downstream p27Kip1 gene expression involvement in pterygium pathogenesis.
25053516 2014 Cyclin D1, p16(INK) (4A) and p27(Kip1) in pancreatic adenocarcinoma: assessing prognostic implications through quantitative image analysis.
25051361 2014 High p27 protein levels in chronic lymphocytic leukemia are associated to low Myc and Skp2 expression, confer resistance to apoptosis and antagonize Myc effects on cell cycle.
25032860 2014 6-Phosphofructo-2-kinase (PFKFB3) promotes cell cycle progression and suppresses apoptosis via Cdk1-mediated phosphorylation of p27.
25003467 2014 Brachyury regulates proliferation of cancer cells via a p27Kip1-dependent pathway.
24947332 2014 Association of single nucleotide polymorphisms in cell cycle regulatory genes with oral cancer susceptibility.
24920291 2014 Association between the p27 rs2066827 variant and tumor multiplicity in patients harboring MEN1 germline mutations.
24867101 2014 Nrdp1 inhibits growth of colorectal cancer cells by nuclear retention of p27.
24819502 2014 A heterozygous frameshift mutation in exon 1 of CDKN1B gene in a patient affected by MEN4 syndrome.
24806449 2014 The Down syndrome-related protein kinase DYRK1A phosphorylates p27(Kip1) and Cyclin D1 and induces cell cycle exit and neuronal differentiation.
24789280 2014 The prognostic value of altered eIF3a and its association with p27 in non-small cell lung cancers.
24741631 2014 Ursodeoxycholic acid influences the expression of p27kip1 but not FoxO1 in patients with non-cirrhotic primary biliary cirrhosis.
24727675 2014 An aberrant microRNA signature in childhood T-cell lymphoblastic lymphoma affecting CDKN1B expression, NOTCH1 and growth factor signaling pathways.
24708177 2014 Stathmin1 regulates p27 expression, proliferation and drug resistance, resulting in poor clinical prognosis in cholangiocarcinoma.
24671224 2014 JAB1 and phospho-Ser10 p27 expression profile determine human hepatocellular carcinoma prognosis.
24667864 2014 TGF-?1 stimulates human Tenon's capsule fibroblast proliferation by miR-200b and its targeting of p27/kip1 and RND3.
24656158 2014 Skp2-mediated degradation of p27 regulates cell cycle progression in compressed human bladder smooth muscle cells.
24643689 2014 Correlations between the expression levels of micro-RNA146b, 221, 222 and p27Kip1 protein mRNA and the clinicopathologic parameters in papillary thyroid cancers.
24574749 2014 Epidermal growth factor upregulates Skp2/Cks1 and p27(kip1) in human extrahepatic cholangiocarcinoma cells.
24532476 2014 p27 variant and corticotropinoma susceptibility: a genetic and in vitro study.
24523023 2014 Lack of association between cyclin-dependent kinase inhibitor 1B rs2066827 polymorphism and breast cancer susceptibility.
24504262 2014 p27KIP1 is involved in ERK1/2-mediated MMP-9 expression via the activation of NF-?B binding in the IL-7-induced migration and invasion of 5637 cells.
24488669 2014 Differential expression of Pim-3, c-Myc, and p-p27 proteins in adenocarcinomas of the gastric cardia and distal stomach.
24460254 2013 MicroRNA-802 promotes osteosarcoma cell proliferation by targeting p27.
24457952 2014 Long non-coding RNA UCA1 promotes breast tumor growth by suppression of p27 (Kip1).
24443386 2014 SKP2 overexpression is associated with increased serine 10 phosphorylation of p27 (pSer10p27) in triple-negative breast cancer.
24427780 2013 Nuclear p27 expression confers a favorable outcome for nasopharyngeal carcinoma patients.
24423924 2014 MicroRNA-196a promotes cervical cancer proliferation through the regulation of FOXO1 and p27Kip1.
24381057 2014 MicroRNA-452 promotes tumorigenesis in hepatocellular carcinoma by targeting cyclin-dependent kinase inhibitor 1B.
24337749 2014 KLRG1 impairs CD4+ T cell responses via p16ink4a and p27kip1 pathways: role in hepatitis B vaccine failure in individuals with hepatitis C virus infection.
24336329 2015 MIF4G domain containing protein regulates cell cycle and hepatic carcinogenesis by antagonizing CDK2-dependent p27 stability.
24336114 2013 S-phase kinase-associated protein 2 knockdown blocks colorectal cancer growth via regulation of both p27 and p16 expression.
24322019 2013 Immunofluorescence expression of Ki-67, p53 and cyclin inhibitors (p16ink4a, p21 and p27) in low-grade cervical lesions versus high-grade cervical lesions. Research study on cell cultures.
24243100 2014 Novel functions of core cell cycle regulators in neuronal migration.
24216315 2014 Expression of cell cycle regulatory proteins in eyelid sebaceous gland carcinoma: low p27 expression predicts poor prognosis.
24185511 2013 Somatic mutation of CDKN1B in small intestine neuroendocrine tumors.
24185120 2014 Prognostic value of p27 in follicular thyroid carcinoma and its relation to radioactive iodine response: does it aid in the modification of risk stratification?
24170542 2014 Adhesion to fibronectin induces p27(Kip1) nuclear accumulation through down-regulation of Jab1 and contributes to cell adhesion-mediated drug resistance (CAM-DR) in RPMI 8,226 cells.
24141420 2013 Notch1-dependent regulation of p27 determines cell fate in colorectal cancer.
24098519 2013 Increased cytoplasmic localization of p27(kip1) and its modulation of RhoA activity during progression of chronic myeloid leukemia.
24078094 2013 Association of CDKN1B gene polymorphisms with susceptibility to breast cancer: a meta-analysis.
24067984 2013 Kaposi's sarcoma-associated herpesvirus transactivator Rta induces cell cycle arrest in G0/G1 phase by stabilizing and promoting nuclear localization of p27kip.
24052415 2014 Cooperative role between p21cip1/waf1 and p27kip1 in premature senescence in glandular proliferative lesions in mice.
24021283 2013 p27(Kip1) inhibits tissue factor expression.
24018641 2014 Knockdown of CRM1 inhibits the nuclear export of p27(Kip1) phosphorylated at serine 10 and plays a role in the pathogenesis of epithelial ovarian cancer.
24008375 2013 Metformin suppresses hepatocellular carcinoma cell growth through induction of cell cycle G1/G0 phase arrest and p21CIP and p27KIP expression and downregulation of cyclin D1 in vitro and in vivo.
23982416 2013 A model of sensitivity and resistance to histone deacetylase inhibitors in diffuse large B cell lymphoma: Role of cyclin-dependent kinase inhibitors.
23966119 Genetic risk factors for hypertrophic scar development.
23965337 2013 A receptor-specific function for Notch2 in mediating vascular smooth muscle cell growth arrest through cyclin-dependent kinase inhibitor 1B.
23963898 2014 Immunohistochemical distribution of cell cycle proteins p27, p57, cyclin D3, PCNA and Ki67 in normal and diabetic human placentas.
23946596 2013 Skp2-RNAi suppresses proliferation and migration of gallbladder carcinoma cells by enhancing p27 expression.
23907123 2013 The p27-Skp2 axis mediates glucocorticoid-induced cell cycle arrest in T-lymphoma cells.
23896637 The negative cell cycle regulators, p27(Kip1), p18(Ink4c), and GSK-3, play critical role in maintaining quiescence of adult human pancreatic ?-cells and restrict their ability to proliferate.
23858559 Expression of p27Kip1 protein in gastric carcinoma.
23832541 2013 Cell cycle suppressor proteins are not related to HPV status or clinical outcome in patients with vulvar carcinoma.
23815208 2013 Expression of cyclin A, cyclin E and p27 in normal, hyperplastic and frankly malignant endometrial samples.
23800691 2013 Multiple endocrine neoplasia syndromes associated with mutation of p27.
23725357 2013 A novel role of proteasomal ?1 subunit in tumorigenesis.
23707388 2013 Fbxl12 triggers G1 arrest by mediating degradation of calmodulin kinase I.
23665265 2013 Mutational analysis of SKP2 and P27 in Chinese Han women with premature ovarian failure.
23624368 2013 Polymorphisms in the p27kip-1 and prohibitin genes denote novel genes associated with melanoma risk in Brazil, a high ultraviolet index region.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23602409 2013 A NIK-IKK? module expands ErbB2-induced tumor-initiating cells by stimulating nuclear export of p27/Kip1.
23594796 2013 Interactions between SAP155 and FUSE-binding protein-interacting repressor bridges c-Myc and P27Kip1 expression.
23584484 2014 miR-194 suppresses metastasis of non-small cell lung cancer through regulating expression of BMP1 and p27(kip1).
23559091 2013 Depletion of histone demethylase KDM2A inhibited cell proliferation of stem cells from apical papilla by de-repression of p15INK4B and p27Kip1.
23555276 2013 A novel mutation in the upstream open reading frame of the CDKN1B gene causes a MEN4 phenotype.
23553486 2013 MicroRNA miR-24 promotes cell proliferation by targeting the CDKs inhibitors p27Kip1 and p16INK4a.
23536577 2013 Undifferentiated embryonic cell transcription factor-1 (UTF1) inhibits the growth of cervical cancer cells by transactivating p27Kip1.
23478441 2013 Regulation of the CRL4(Cdt2) ubiquitin ligase and cell-cycle exit by the SCF(Fbxo11) ubiquitin ligase.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23440295 2013 DFMO/eflornithine inhibits migration and invasion downstream of MYCN and involves p27Kip1 activity in neuroblastoma.
23438793 2013 The diagnostic value of p27 in comparison to p57 in differentiation between different gestational trophoblastic diseases.
23382584 Association of p21, p21 p27 and p21 p53 status to histological subtypes and prognosis in low-stage epithelial ovarian cancer.
23339869 2013 TRIP6 regulates p27 KIP1 to promote tumorigenesis.
23312942 2013 A single nucleotide polymorphism in the p27(Kip1) gene is associated with primary patency of lower extremity vein bypass grafts.
23301842 Clinical significance of overexpressed cyclin-dependent kinase subunits 1 and 2 in esophageal carcinoma.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23230143 2013 Cytoplasmic mislocalization of p27 and CDK2 mediates the anti-migratory and anti-proliferative effects of Nodal in human trophoblast cells.
23221604 2013 P27 as a prognostic factor of early cervical carcinoma.
23221544 2012 Up-regulation of p27Kip1 protects hES cells from differentiation-associated and caspase 3-dependent apoptosis.
23203004 2013 BRAF (V600E) associates with cytoplasmatic localization of p27kip1 and higher cytokeratin 19 expression in papillary thyroid carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184467 2013 Stat6 cooperates with Sp1 in controlling breast cancer cell proliferation by modulating the expression of p21(Cip1/WAF1) and p27 (Kip1).
23133524 2012 Gatifloxacin induces S and G2-phase cell cycle arrest in pancreatic cancer cells via p21/p27/p53.
23077088 2013 Abnormalities of the der(12)t(12;21) in ETV6-RUNX1 acute lymphoblastic leukemia.
23077062 2012 Oligodendrocyte regeneration after neonatal hypoxia requires FoxO1-mediated p27Kip1 expression.
23062638 2012 Oncogenic role of Skp2 and p27Kip1 in intraductal proliferative lesions of the breast.
23034899 2013 Genetic variants of p21 and p27 and hepatocellular cancer risk in a Chinese Han population: a case-control study.
23029392 2012 Estrogen and progesterone regulate p27kip1 levels via the ubiquitin-proteasome system: pathogenic and therapeutic implications for endometrial cancer.
22995332 2013 Early mitotic inhibitor-1, an anaphase-promoting complex/cyclosome inhibitor, can control tumor cell proliferation in hepatocellular carcinoma: correlation with Skp2 stability and degradation of p27(Kip1).
22988851 2012 Cell cycle regulation by the intrinsically disordered proteins p21 and p27.
22970236 2012 Phosphorylation and subcellular localization of p27Kip1 regulated by hydrogen peroxide modulation in cancer cells.
22908227 2012 Serine 123 phosphorylation modulates p21 protein stability and activity by suppressing ubiquitin-independent proteasomal degradation.
22823061 2012 p27(Kip1) V109G polymorphism and cancer risk: a systematic review and meta-analysis.
22820506 2012 Down-regulation of estrogen receptor ? (ER?) transcriptional activity by p27 is mediated by inhibition of ER? nuclear localization and modulation of the ER? transcriptional complex.
22770219 2012 Acetylation-dependent regulation of Skp2 function.
22763761 2012 Immunohistochemical expression of cell-cycle regulators in pediatric embryonal brain tumors.
22710719 2013 MYC antagonizes the differentiation induced by imatinib in chronic myeloid leukemia cells through downregulation of p27(KIP1.).
22675932 2012 [Expression and their significance of Jab1 p27kip1 in laryngeal squamous cell carcinoma and Hep-2 cells].
22665064 2013 The deubiquitylase USP37 links REST to the control of p27 stability and cell proliferation.
22650359 2012 Over-expression of BMPR-IB reduces the malignancy of glioblastoma cells by upregulation of p21 and p27Kip1.
22632967 2012 Cyclin F-mediated degradation of ribonucleotide reductase M2 controls genome integrity and DNA repair.
22586611 2011 PPM1H is a p27 phosphatase implicated in trastuzumab resistance.
22553813 2012 Value of immunohistochemical expression of p27 and galectin-3 in differentiation between follicular adenoma and follicular carcinoma.
22511779 2012 p27kip1 protein levels reflect a nexus of oncogenic signaling during cell transformation.
22492278 2012 Expression of Spy1 protein in human non-Hodgkin's lymphomas is correlated with phosphorylation of p27 Kip1 on Thr187 and cell proliferation.
22469187 2012 Arecoline downregulates levels of p21 and p27 through the reactive oxygen species/mTOR complex 1 pathway and may contribute to oral squamous cell carcinoma.
22446332 2012 miR-181b promotes hepatic stellate cells proliferation by targeting p27 and is elevated in the serum of cirrhosis patients.
22404445 2012 p27(kip1) upregulated by hnRNPC1/2 antagonizes CagA (a virulence factor of Helicobacter pylori)-mediated pathogenesis.
22350412 2012 Jab1/CSN5 negatively regulates p27 and plays a role in the pathogenesis of nasopharyngeal carcinoma.
22343731 2012 MiR-196a is upregulated in gastric cancer and promotes cell proliferation by downregulating p27(kip1).
22311264 2012 Jun activation domain-binding protein 1 expression in oral squamous cell carcinomas inversely correlates with the cell cycle inhibitor p27.
22296117 2012 Differential expression of forkhead box M1 and its downstream cyclin-dependent kinase inhibitors p27(kip1) and p21(waf1/cip1) in the diagnosis of pulmonary neuroendocrine tumours.
22293177 2012 p27(Kip1) controls cytokinesis via the regulation of citron kinase activation.
22291433 2012 Cyclin-dependent kinase inhibitor 1B (CDKN1B) gene variants in AIP mutation-negative familial isolated pituitary adenoma kindreds.
22221586 2012 Lack of prognostic significance of p16 and p27 after radical prostatectomy in hormone-naïve prostate cancer.
22199306 2011 Loss of p27KIP1 expression in fully-staged node-negative breast cancer: association with lack of hormone receptors in T1a/b, but not T1c infiltrative ductal carcinoma.
22161326 2012 Molecular systems biology of Sic1 in yeast cell cycle regulation through multiscale modeling.
22158041 2012 A p27Kip1 mutant that does not inhibit CDK activity promotes centrosome amplification and micronucleation.
22158033 2012 Involvement of the SKP2-p27(KIP1) pathway in suppression of cancer cell proliferation by RECK.
22134138 2011 Artemis interacts with the Cul4A-DDB1DDB2 ubiquitin E3 ligase and regulates degradation of the CDK inhibitor p27.
22120635 2011 XLG?olf regulates expression of p27Kip1 in a CSN5 and CDK2 dependent manner.
22110200 2011 Differential Akt signalling in non-seminomatous testicular germ cell tumors.
22094872 2012 P27/SKP-2 histochemical profile is relevant to malignant salivary gland tumors (MST) histogenesis and tumor grade.
22036806 2012 Cytoplasmic p27Kip1 counteracts the pro-apoptotic function of the open conformation of PTEN by retention and destabilization of PTEN outside of the nucleus.
22026581 2012 Novel mutations in MEN1, CDKN1B and AIP genes in patients with multiple endocrine neoplasia type 1 syndrome in Spain.
22014979 2012 JNK signaling activity regulates cell-cell adhesions via TM4SF5-mediated p27(Kip1) phosphorylation.
21981759 2012 High cytoplasmic expression of p27(Kip1) is associated with a worse cancer-specific survival in clear cell renal cell carcinoma.
21907315 2011 Human bone marrow-derived stem cell proliferation is inhibited by hepatocyte growth factor via increasing the cell cycle inhibitors p53, p21 and p27.
21885849 2011 Deficient p27 phosphorylation at serine 10 increases macrophage foam cell formation and aggravates atherosclerosis through a proliferation-independent mechanism.
21841827 2012 Promotion of cytoplasmic mislocalization of p27 by Helicobacter pylori in gastric cancer.
21840777 2011 Mechanism of p27 upregulation induced by downregulation of cathepsin B and uPAR in glioma.
21828232 2011 Prognostic significance of cytoplasmic p27 expression in human melanoma.
21813412 2011 The role of p27(Kip1) in dasatinib-enhanced paclitaxel cytotoxicity in human ovarian cancer cells.
21795702 2011 WW domain-containing E3 ubiquitin protein ligase 1 (WWP1) delays cellular senescence by promoting p27(Kip1) degradation in human diploid fibroblasts.
21785466 2012 New pyrazolo[3,4-d]pyrimidine SRC inhibitors induce apoptosis in mesothelioma cell lines through p27 nuclear stabilization.
21780161 2011 Magnesium deficiency suppresses cell cycle progression mediated by increase in transcriptional activity of p21(Cip1) and p27(Kip1) in renal epithelial NRK-52E cells.
21762277 2012 Clinicopathological significance of cyclooxygenase-2 and cell cycle-regulatory proteins expression in patients with esophageal squamous cell carcinoma.
21715331 2011 Homeodomain-interacting protein kinase-2 stabilizes p27(kip1) by its phosphorylation at serine 10 and contributes to cell motility.
21715330 2011 Incomplete folding upon binding mediates Cdk4/cyclin D complex activation by tyrosine phosphorylation of inhibitor p27 protein.
21637966 2012 Expression of cell cycle regulators p21 and p27 as predictors of disease outcome in colorectal carcinoma.
21628527 2011 Selective ubiquitylation of p21 and Cdt1 by UBCH8 and UBE2G ubiquitin-conjugating enzymes via the CRL4Cdt2 ubiquitin ligase complex.
21575944 2011 Sequence analysis of the CDKN1B gene in patients with premature ovarian failure reveals a novel mutation potentially related to the phenotype.
21575583 2011 The role of the LH subdomain in the function of the Cip/Kip cyclin-dependent kinase regulators.
21552422 2011 miR-148a promoted cell proliferation by targeting p27 in gastric cancer cells.
21508681 CUG-binding protein represses translation of p27Kip1 mRNA through its internal ribosomal entry site.
21478681 2011 The cell cycle inhibitor p27Kip¹ controls self-renewal and pluripotency of human embryonic stem cells by regulating the cell cycle, Brachyury and Twist.
21478095 2010 Alterations in TP53, cyclin D2, c-Myc, p21WAF1/CIP1 and p27KIP1 expression associated with progression in B-CLL.
21464733 2011 Significance of cell cycle regulatory proteins as malignant and prognostic biomarkers in ovarian epithelial tumors.
21454826 2011 Association of genetic polymorphisms in cell-cycle control genes and susceptibility to endometrial cancer among Chinese women.
21423803 2011 Role of T198 modification in the regulation of p27(Kip1) protein stability and function.
21423214 2011 Phosphorylation of p27Kip1 by JAK2 directly links cytokine receptor signaling to cell cycle control.
21422114 2011 CDKN1B, encoding the cyclin-dependent kinase inhibitor 1B (p27), is located in the minimally deleted region of 12p abnormalities in myeloid malignancies and its low expression is a favorable prognostic marker in acute myeloid leukemia.
21371741 2012 Immunolocalization of PCNA, Ki67, p27 and p57 in normal and dexamethasone-induced intrauterine growth restriction placental development in rat.
21355095 2011 miR-221 and miR-155 regulate human dendritic cell development, apoptosis, and IL-12 production through targeting of p27kip1, KPC1, and SOCS-1.
21351264 2010 p27Kip1 is a predictive factor for tamoxifen treatment response but not a prognostic marker in premenopausal breast cancer patients.
21338280 2011 Overexpression of phosphorylated p27 Kip1 at threonine 187 may predict outcome in aggressive B-cell lymphomas.
21310472 2011 Nuclear P27 expression in benign, borderline (LMP) and invasive tumors of the ovary and its association with prognosis: a gynecologic oncology group study.
21289244 2011 Somatic mutation and germline sequence abnormalities in CDKN1B, encoding p27Kip1, in sporadic parathyroid adenomas.
21278490 GSK-3 inactivation or depletion promotes ?-cell replication via down regulation of the CDK inhibitor, p27 (Kip1).
21264218 2011 Identification of distinctive patterns of USP19-mediated growth regulation in normal and malignant cells.
21245140 2011 SKP2 oncogene is a direct MYC target gene and MYC down-regulates p27(KIP1) through SKP2 in human leukemia cells.
21236467 2011 Expression of Pirh2, a p27(Kip1) ubiquitin ligase, in hepatocellular carcinoma: correlation with p27(Kip1) and cell proliferation.
21224344 2011 Suppression of colonic polyposis by homeoprotein CDX2 through its nontranscriptional function that stabilizes p27Kip1.
21216562 2011 Variation of gene expression profile linked to p27 (Kip1) Ser(10) phosphorylation status in MCF-7 cell line.
21182779 2010 Chemical genetics approach to restoring p27Kip1 reveals novel compounds with antiproliferative activity in prostate cancer cells.
21177330 2011 CDKN1B V109G polymorphism a new prognostic factor in sporadic medullary thyroid carcinoma.
21115898 2010 Altered expression of cell cycle and apoptotic proteins in human liver pathologies.
21075101 2011 Tumor necrosis factor-? regulates p27 kip expression and apoptosis in smooth muscle cells of human carotid plaques via forkhead transcription factor O1.
21067268 2011 The role of p27(Kip1) phosphorylation at serine 10 in the migration of malignant glioma cells in vitro.
21062737 2011 Cell-permeable carboxyl-terminal p27(Kip1) peptide exhibits anti-tumor activity by inhibiting Pim-1 kinase.
21054888 2010 Oridonin induces apoptosis and senescence in colorectal cancer cells by increasing histone hyperacetylation and regulation of p16, p21, p27 and c-myc.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21045237 2011 CDKN1B/p27 expression in peripheral T cell lymphoma not otherwise specified.
20980721 2011 p27kip1: a new multiple endocrine neoplasia gene?
20890423 2010 Clinicopathological significance of expression of Tspan-1, Jab1 and p27 in human hepatocellular carcinoma.
20851109 2010 CaMKII phosphorylates serine 10 of p27 and confers apoptosis resistance to HeLa cells.
20833334 2010 MEN-4 and other multiple endocrine neoplasias due to cyclin-dependent kinase inhibitors (p27(Kip1) and p18(INK4C)) mutations.
20824794 2010 A novel germline CDKN1B mutation causing multiple endocrine tumors: clinical, genetic and functional characterization.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20818424 2010 Rheb activates AMPK and reduces p27Kip1 levels in Tsc2-null cells via mTORC1-independent mechanisms: implications for cell proliferation and tumorigenesis.
20818387 2010 A Pumilio-induced RNA structure switch in p27-3' UTR controls miR-221 and miR-222 accessibility.
20813693 2010 [Expression of P27kip1 in renal cell carcinoma and its clinical significance].
20723295 2010 [Levels of P27Kip1 expression and apoptosis in HL-60 cells after treatment with TGF-ß1 and/or arsenic trioxide].
20713460 2010 Protein expression analysis of chronic lymphocytic leukemia defines the effect of genetic aberrations and uncovers a correlation of CDK4, P27 and P53 with hierarchical risk.
20698225 JAB1 expression is associated with inverse expression of p27(kip1) in hepatocellular carcinoma.
20683061 2010 CCND1 and CDKN1B polymorphisms and risk of breast cancer.
20668328 Absence of CIP1/KIP1 hypermethylation in gastric cancer patients from Northern Brazil.
20661724 2010 Increased expression of p27 is associated with the cisplatin resistance in gastric cancer cell line YCC-3.
20647308 2010 p27Kip1 mediates addiction of ovarian cancer cells to MYCC (c-MYC) and their dependence on MYC paralogs.
20631637 2010 Deregulation of p27 and cyclin D1/D3 control over mitosis is associated with unfavorable prognosis in non-small cell lung cancer, as determined in 405 operated patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20626751 2010 Loss of nuclear p27(kip1) and ?-dystroglycan is a frequent event and is a strong predictor of poor outcome in renal cell carcinoma.
20624000 2010 miR-221/222 suppression protects against endoplasmic reticulum stress-induced apoptosis via p27(Kip1)- and MEK/ERK-mediated cell cycle regulation.
20615757 2010 Analysis of cyclin-dependent kinase inhibitor 1B mutation in Han Chinese women with premature ovarian failure.
20608352 2010 [Effects of laminarin sulphate on the expressions of PTEN and P271kip1 in prostate cancer PC-3 cells].
20565904 2010 Necrosis related HIF-1alpha expression predicts prognosis in patients with endometrioid endometrial carcinoma.
20558775 2011 Heparin inhibits pulmonary artery smooth muscle cell proliferation through guanine nucleotide exchange factor-H1/RhoA/Rho kinase/p27.
20546339 2010 Cumulative alterations of p27-related cell-cycle regulators in the development of endometriosis-associated ovarian clear cell adenocarcinoma.
20541671 2010 The MENX syndrome and p27: relationships with multiple endocrine neoplasia.
20541486 2010 Gastric adenocarcinoma and Helicobacter pylori: correlation with p53 mutation and p27 immunoexpression.
20530095 2010 Prevalence of AIP mutations in a large series of sporadic Italian acromegalic patients and evaluation of CDKN1B status in acromegalic patients with multiple endocrine neoplasia.
20508912 2010 Identification of p27/KIP1 expression level as a candidate biomarker of response to rapalogs therapy in human cancer.
20507346 2010 The role of germline AIP, MEN1, PRKAR1A, CDKN1B and CDKN2C mutations in causing pituitary adenomas in a large cohort of children, adolescents, and patients with genetic syndromes.
20492341 2010 Hypermethylation downregulates Runx3 gene expression and its restoration suppresses gastric epithelial cell growth by inducing p27 and caspase3 in human gastric cancer.
20458559 2011 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20448040 2010 The B56gamma3 regulatory subunit of protein phosphatase 2A (PP2A) regulates S phase-specific nuclear accumulation of PP2A and the G1 to S transition.
20399237 2010 TM4SF5 accelerates G1/S phase progression via cytosolic p27Kip1 expression and RhoA activity.
20372838 2010 Altered expression of Akt signaling pathway parameters in prostate needle biopsies derived from benign, adjacent and cancerous tissue.
20193371 2009 [Effects of transfected pIRES-p21(waf1)-p27(kip1) gene on the duplication of centrosomes and the proliferation of breast cancer cell line MCF-7].
20146005 2011 Clinical significance of miR-221 and its inverse correlation with p27Kip¹ in hepatocellular carcinoma.
20143334 2010 Profilin-1 overexpression inhibits proliferation of MDA-MB-231 breast cancer cells partly through p27kip1 upregulation.
20108172 2011 Phosphorylated p27Kip1 on Thr157 is an important prognosis in human hepatocellular carcinoma in vivo and in vitro.
20075119 2010 Allelic variant at -79 (C>T) in CDKN1B (p27Kip1) confers an increased risk of thyroid cancer and alters mRNA levels.
20074558 2010 p27 Nuclear localization and growth arrest caused by perlecan knockdown in human endothelial cells.
20059402 2010 p27KIP1 expression in gastric cancer: differential pathways in the histological subtypes associated with Helicobacter pylori infection.
20054616 2010 Sprouty1 inhibits angiogenesis in association with up-regulation of p21 and p27.
20011080 2009 PKC alpha affects cell cycle progression and proliferation in human RPE cells through the downregulation of p27kip1.
19959471 2010 Mitogenic regulation of p27(Kip1) gene is mediated by AP-1 transcription factors.
19953484 2009 [Up-regulation of p27(kip1) by miR-221/222 antisense oligonucleotides enhances the radiosensitivity of U251 glioblastoma].
19952944 2010 Cytoplasmic p27 expression is an independent prognostic factor in ovarian cancer.
19938192 2009 Macrophage migration inhibitory factor regulates proliferation of gastric cancer cells via the PI3K/Akt pathway.
19924135 2010 Alterations of the cell-cycle inhibitors p27(KIP1) and p16(INK4a) are frequent in blastic plasmacytoid dendritic cell neoplasms.
19923826 2009 Study on the different expression of molecular markers between cardiac cancer and distal gastric cancer and their correlations with clinicopathological features.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19912438 2011 Human ribosomal protein S13 promotes gastric cancer growth through down-regulating p27(Kip1).
19910837 2010 Genetic variants of p21 and p27 and pancreatic cancer risk in non-Hispanic Whites: a case-control study.
19889619 2010 Prognostic significance of S-phase kinase-associated protein 2 and p27kip1 in patients with diffuse large B-cell lymphoma: effects of rituximab.
19887899 2009 The function of p27 KIP1 during tumor development.
19860623 2009 Indirubin derivatives inhibit malignant lymphoid cell proliferation.
19843869 2009 p27Kip1 stabilization is essential for the maintenance of cell cycle arrest in response to DNA damage.
19838216 2010 Knockdown of protein tyrosine phosphatase SHP-1 inhibits G1/S progression in prostate cancer cells through the regulation of components of the cell-cycle machinery.
19832036 2009 Upregulated p27kip1 can downregulate survivin expression and inhibit telomerase activity in gastric carcinoma cells.
19819988 2009 BMP-4 induction of arrest and differentiation of osteoblast-like cells via p21 CIP1 and p27 KIP1 regulation.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19777788 2009 Expression of P27, Ki67 and P53 in squamous cell carcinoma, actinic keratosis and Bowen disease.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19734935 2009 Exogenous p27KIP1 expression induces anti-tumour effects and inhibits the EGFR/PI3K/Akt signalling pathway in PC3 cells.
19730150 2009 Antisense inhibition of microRNA-21 or -221 arrests cell cycle, induces apoptosis, and sensitizes the effects of gemcitabine in pancreatic adenocarcinoma.
19727727 2010 DNA methylation analysis of tumor suppressor genes in monoclonal gammopathy of undetermined significance.
19724954 2010 Inverse correlation between Skp2 and p27(Kip1) in normal endometrium and endometrial carcinoma.
19723645 2009 Low p27 expression predicts early relapse and death in postmenopausal hormone receptor-positive breast cancer patients receiving adjuvant tamoxifen therapy.
19698214 2009 [Expression of P27(kip1) and cyclin G in patients with acute leukemia and its correlation].
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19667240 2009 p27kip1-838C>A single nucleotide polymorphism is associated with restenosis risk after coronary stenting and modulates p27kip1 promoter activity.
19657571 2009 SKP2 siRNA inhibits the degradation of P27kip1 and down-regulates the expression of MRP in HL-60/A cells.
19636294 2009 Bortezomib-mediated expression of p27Kip1 through S-phase kinase protein 2 degradation in epithelial ovarian cancer.
19631451 2009 p27-Associated G1 arrest induced by hinokitiol in human malignant melanoma cells is mediated via down-regulation of pRb, Skp2 ubiquitin ligase, and impairment of Cdk2 function.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19594747 2009 Detection of gene copy number aberrations in mantle cell lymphoma by a single quantitative multiplex PCR assay: clinicopathological relevance and prognosis value.
19587092 2009 Genetic susceptibility to the development and progression of breast cancer associated with polymorphism of cell cycle and ubiquitin ligase genes.
19584057 2009 Pin1 catalyzes conformational changes of Thr-187 in p27Kip1 and mediates its stability through a polyubiquitination process.
19576211 2009 Inhibition of thromboxane synthase induces lung cancer cell death via increasing the nuclear p27.
19559782 2009 Expression levels of NF-Y target genes changed by CDKN1B correlate with clinical prognosis in multiple cancers.
19557642 2009 Proteasome inhibitor MG-132 mediated expression of p27Kip1 via S-phase kinase protein 2 degradation induces cell cycle coupled apoptosis in primary effusion lymphoma cells.
19556892 2009 Regulated expression of cofilin and the consequent regulation of p27(kip1) are essential for G(1) phase progression.
19542220 2009 Mirk regulates the exit of colon cancer cells from quiescence.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19533041 2009 Iron-saturated lactoferrin stimulates cell cycle progression through PI3K/Akt pathway.
19531414 2009 Prognostic significance of p27Kip1, Ki-67, and CRTC1-MAML2 fusion transcript in mucoepidermoid carcinoma: a molecular and clinicopathologic study of 101 cases.
19522032 2009 Effect of p27mt gene on apoptosis of the colorectal cancer cell line Lovo.
19493606 2009 The V109G polymorphism in the p27 gene is associated with endometriosis.
19474519 2009 Mutation analysis of MEN1, HRPT2, CASR, CDKN1B, and AIP genes in primary hyperparathyroidism patients with features of genetic predisposition.
19473963 2009 Nuclear targeting of 6-phosphofructo-2-kinase (PFKFB3) increases proliferation via cyclin-dependent kinases.
19470470 2009 RSK1 drives p27Kip1 phosphorylation at T198 to promote RhoA inhibition and increase cell motility.
19461157 2009 Cytoplasmic localization of Jab1 and p27 Kip1 might be associated with invasiveness of papillary thyroid carcinoma.
19451650 2009 Phosphorylation of p27Kip1 by Epstein-Barr virus protein kinase induces its degradation through SCFSkp2 ubiquitin ligase actions during viral lytic replication.
19445020 2009 High expression of Pirh2, an E3 ligase for p27, is associated with low expression of p27 and poor prognosis in head and neck cancers.
19430707 2009 Identification of aberrant cell cycle regulation in Epstein-Barr virus-associated nasopharyngeal carcinoma by cDNA microarray and gene set enrichment analysis.
19424645 2009 Effect of p27 on motility of MDA-MB-231 breast cancer cells.
19397698 2009 Human papillomavirus 16 E6/E7-immortalized human gingival keratinocytes with epithelial mesenchymal transition acquire increased expression of cIAP-1, Bclx and p27(Kip1).
19379560 2009 [Role of P27(Kip1) and TGF-beta1 in APL cell apoptosis induced by As(2)O(3)].
19351827 2009 Thrombin induces tumor cell cycle activation and spontaneous growth by down-regulation of p27Kip1, in association with the up-regulation of Skp2 and MiR-222.
19349901 2009 Significance of Jab1 expression in human esophageal squamous cell carcinoma.
19304516 2009 [Effect of valproic acid on the expression of P27(Kip1) and P170 and drug resistance of HL-60/HT cells].
19298520 2010 p27(Kip1) as a prognostic factor in breast cancer: a systematic review and meta-analysis.
19293259 2009 Combined PTEN and p27kip1 protein expression patterns are associated with obesity and prognosis in endometrial carcinomas.
19281796 2009 Regulation of FOXO1-mediated transcription and cell proliferation by PARP-1.
19276255 2009 p27Kip1 in stage III colon cancer: implications for outcome following adjuvant chemotherapy in cancer and leukemia group B protocol 89803.
19273599 2009 miR-181a regulates cap-dependent translation of p27(kip1) mRNA in myeloid cells.
19266349 2009 Nkx3.1 and p27(KIP1) cooperate in proliferation inhibition and apoptosis induction in human androgen-independent prostate cancer cells.
19263441 2009 Molecular effects of soy phytoalexin glyceollins in human prostate cancer cells LNCaP.
19258477 2009 Candidate gene analysis using imputed genotypes: cell cycle single-nucleotide polymorphisms and ovarian cancer risk.
19236751 2009 [P27(Kip1), cyclin E and endogenous TGF-beta1 changes in apoptosis of NB4 cells induced by As(2)O(3) and/or TGF-beta1 and their significance].
19221487 2009 MicroRNAs181 regulate the expression of p27Kip1 in human myeloid leukemia cells induced to differentiate by 1,25-dihydroxyvitamin D3.
19187271 2009 High intracellular content of cyclin-dependent kinase inhibitor p27(Kip1) in early- and intermediate stage B-cell chronic lymphocytic leukemia lymphocytes predicts rapid progression of the disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19170105 2009 CDK inhibitors selectively diminish cell cycle controlled activation of the histone H4 gene promoter by p220NPAT and HiNF-P.
19141585 2009 Rare germline mutations in cyclin-dependent kinase inhibitor genes in multiple endocrine neoplasia type 1 and related states.
19139918 2009 Expression of Jun activation domain-binding protein 1 and Ser10 phosphorylated p27 protein in human epithelial ovarian carcinoma.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19123975 2008 Direct characterization of E2-dependent target specificity and processivity using an artificial p27-linker-E2 ubiquitination system.
19112177 2009 Histidine triad nucleotide-binding protein 1 up-regulates cellular levels of p27KIP1 by targeting ScfSKP2 ubiquitin ligase and Src.
19107213 2008 The inhibition of the highly expressed miR-221 and miR-222 impairs the growth of prostate carcinoma xenografts in mice.
19106631 Structure and activity of the internal ribosome entry site within the human p27 Kip1 5'-untranslated region.
19096232 2008 Immunohistochemical analysis of cell cycle-related molecules in gastric carcinoma: prognostic significance, correlation with clinicopathological parameters, proliferation and apoptosis.
19093261 2008 MG-132 inhibits telomerase activity, induces apoptosis and G(1) arrest associated with upregulated p27kip1 expression and downregulated survivin expression in gastric carcinoma cells.
19088079 2009 Induction of microRNA-221 by platelet-derived growth factor signaling is critical for modulation of vascular smooth muscle phenotype.
19082479 2009 p27Kip1 is inactivated in human colorectal cancer by cytoplasmic localization associated with activation of Akt/PKB.
19079342 2009 Id-1 activates Akt-mediated Wnt signaling and p27(Kip1) phosphorylation through PTEN inhibition.
19077036 2009 E2F-like elements in p27(Kip1) promoter specifically sense deregulated E2F activity.
19075005 2009 p27Kip1 inhibits cyclin D-cyclin-dependent kinase 4 by two independent modes.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19056892 2008 A functional link between Wnt signaling and SKP2-independent p27 turnover in mammary tumors.
19040567 2008 Lineage specific composition of cyclin D-CDK4/CDK6-p27 complexes reveals distinct functions of CDK4, CDK6 and individual D-type cyclins in differentiating cells of embryonic origin.
19038492 2009 Identification of genes, including the gene encoding p27Kip1, regulated by serine 276 phosphorylation of the p65 subunit of NF-kappaB.
19034576 2009 Immunohistochemically detected expression of p27(Kip1) and Skp2 predicts survival in patients with intrahepatic cholangiocarcinomas.
19020940 2009 Polymorphisms of p16, p27, p73, and MDM2 modulate response and survival of pancreatic cancer patients treated with preoperative chemoradiation.
19010853 2008 Loss of nuclear p27 expression and its prognostic role in relation to cyclin E and p53 mutation in gastroenteropancreatic neuroendocrine tumors.
18987662 2009 The role of VEGF and a functional link between VEGF and p27Kip1 in acute myeloid leukemia.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18953829 2008 [Expression variation and significance of Skp2 and p27(kip1) during the proliferation of Jurkat cells].
18925698 2008 Cyclin D1 and p27 expression as prognostic factor in papillary carcinoma of thyroid: association with clinicopathological parameters.
18922157 2008 Prognostic implication of p27Kip1, Skp2 and Cks1 expression in renal cell carcinoma: a tissue microarray study.
18855981 2008 Antitumor bioactivity of adenovirus-mediated p27mt in colorectal cancer cell line SW480.
18838534 2008 Myc inhibits p27-induced erythroid differentiation of leukemia cells by repressing erythroid master genes without reversing p27-mediated cell cycle arrest.
18823025 2008 Genetic variations in cell-cycle pathway and the risk of oral premalignant lesions.
18822693 Significance of p57(Kip2) down-regulation in oncogenesis of bladder carcinoma: an immunohistochemical study.
18818877 2008 On the mechanism of inhibition of p27 degradation by 15-deoxy-Delta12,14-prostaglandin J2 in lymphoblasts of Alzheimer's disease patients.
18818203 2008 G0 function of BCL2 and BCL-xL requires BAX, BAK, and p27 phosphorylation by Mirk, revealing a novel role of BAX and BAK in quiescence regulation.
18808421 2008 p27(Kip1)is overexpressed in very early stages of hepatocarcinogenesis.
18805092 2008 Structural insights into NEDD8 activation of cullin-RING ligases: conformational control of conjugation.
18794148 2008 The peptidyl-isomerase Pin1 regulates p27kip1 expression through inhibition of Forkhead box O tumor suppressors.
18788572 2008 [Single nucleotide polymorphisms in cell cycle regulator p21 and p27 genes are associated with susceptibility to epithelial ovarian cancer].
18781093 2008 p27Kip1 promotes migration of metastatic hepatocellular carcinoma cells.
18769118 2008 Suppression of EBNA1 expression inhibits growth of EBV-positive NK/T cell lymphoma cells.
18766473 2008 Expression of p21cip1, p27kip1, and p16INk4a cyclin-dependent kinase inhibitors in papillary thyroid carcinoma: correlation with clinicopathological factors.
18758183 2009 P27 and P53 gene polymorphisms and restenosis following coronary implantation of drug-eluting stents.
18756055 2008 Cyclin-dependent kinase inhibitor p27Kip1 controls growth and cell cycle progression in human uterine leiomyoma.
18710949 2008 Phosphorylation of p27Kip1 regulates assembly and activation of cyclin D1-Cdk4.
18710468 2009 Assessment of p27 (cyclin-dependent kinase inhibitor 1B) and aryl hydrocarbon receptor-interacting protein (AIP) genes in multiple endocrine neoplasia (MEN1) syndrome patients without any detectable MEN1 gene mutations.
18708351 2008 MicroRNA-221/222 confers tamoxifen resistance in breast cancer by targeting p27Kip1.
18695910 2008 Skp2, p27kip1 and EGFR assessment in head and neck squamous cell carcinoma: prognostic implications.
18694622 2008 Polymorphisms of p21 and p27 jointly contribute to an earlier age at diagnosis of pancreatic cancer.
18691549 2008 A prostatic intraepithelial neoplasia-dependent p27 Kip1 checkpoint induces senescence and inhibits cell proliferation and cancer progression.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18673462 2009 Germline mutations in the CDKN1B gene encoding p27 Kip1 are a rare cause of multiple endocrine neoplasia type 1.
18663445 2009 p27 and salivary cancer.
18647205 2009 Different expression patterns of p27 and p57 proteins in benign and malignant melanocytic neoplasms and in cultured human melanocytes.
18645269 2008 CDKN1B V109G polymorphism frequency and prostate cancer risk in Taiwan.
18644126 2008 Over-expression of Skp2 is associated with resistance to preoperative doxorubicin-based chemotherapy in primary breast cancer.
18615582 2008 S10 phosphorylation of p27 mediates atRA induced growth arrest in ovarian carcinoma cell lines.
18604603 2009 Skp2 inversely correlates with p27 and tuberin in transformed cells.
18604165 2008 Confluence-induced cell cycle exit involves pre-mitotic CDK inhibition by p27(Kip1) and cyclin D1 downregulation.
18598941 2008 Argyrin a reveals a critical role for the tumor suppressor protein p27(kip1) in mediating antitumor activities in response to proteasome inhibition.
18593937 2008 Activation of protein kinase G Increases the expression of p21CIP1, p27KIP1, and histidine triad protein 1 through Sp1.
18593906 2008 Pim kinases promote cell cycle progression by phosphorylating and down-regulating p27Kip1 at the transcriptional and posttranscriptional levels.
18583941 2008 Downregulation of both p21/Cip1 and p27/Kip1 produces a more aggressive prostate cancer phenotype.
18568767 2008 The expression of Bcl-XL, Bcl-XS and p27Kip1 in topotecan-induced apoptosis in hepatoblastoma HepG2 cell line.
18543099 2009 No evidence that CDKN1B (p27) polymorphisms modify breast cancer risk in BRCA1 and BRCA2 mutation carriers.
18521080 2008 MiR-221 controls CDKN1C/p57 and CDKN1B/p27 expression in human hepatocellular carcinoma.
18514141 2008 Skp2/p27 expression profile is correlated with Epstein-Barr virus status in extranodal nasal-type natural killer cell lymphoma.
18507837 2008 Effects of common germline genetic variation in cell cycle control genes on breast cancer survival: results from a population-based cohort.
18476592 2007 [Expression and relationship of p27(kip1) and its nuclear export factor Jab1 in lymphoma cell Jurkat].
18459109 2008 Association between polymorphisms in cell cycle genes and advanced prostate carcinoma.
18437054 2008 Involvement of PI3K/AKT/GSK3beta pathway in tetrandrine-induced G1 arrest and apoptosis.
18425369 2008 PTEN and p27Kip1 are not downregulated in the majority of renal cell carcinomas--implications for Akt activation.
18415709 2008 Expression of p21(waf1/cip1), p27 (kip1), p63 and androgen receptor in low and high Gleason score prostate cancer.
18408738 2008 p27 Kip1 nuclear localization and cyclin-dependent kinase inhibitory activity are regulated by glycogen synthase kinase-3 in human colon cancer cells.
18393360 2008 c-Myc represses FOXO3a-mediated transcription of the gene encoding the p27(Kip1) cyclin dependent kinase inhibitor.
18385518 2008 Endothelin-1 couples betaPix to p66Shc: role of betaPix in cell proliferation through FOXO3a phosphorylation and p27kip1 down-regulation independently of Akt.
18363870 2008 Expression of Foxo3a in non-Hodgkin's lymphomas is correlated with cell cycle inhibitor p27.
18350604 2008 Molecular mechanism underlying the functional loss of cyclindependent kinase inhibitors p16 and p27 in hepatocellular carcinoma.
18346358 2007 [Expression and significance of Ser10 phosphorylated p27(kip1) and JAB1 protein in human hepatocellular carcinoma].
18334933 2008 Expression of senescence-related genes in human corneal endothelial cells.
18334837 2008 Large-scale analysis of cell cycle regulators in urothelial bladder cancer identifies p16 and p27 as potentially useful prognostic markers.
18327303 2008 Pioglitazone, a PPAR-gamma ligand, exerts cytostatic/cytotoxic effects against cancer cells, that do not result from inhibition of proteasome.
18321488 2009 P27Kip1 is down-regulated in the endometrium of women with endometriosis.
18305109 2008 A novel endogenous human CaMKII inhibitory protein suppresses tumor growth by inducing cell cycle arrest via p27 stabilization.
18301453 2006 The role of cyclins and cyclins inhibitors in the multistep process of HPV-associated cervical carcinoma.
18288099 2008 Mutational analysis of CDKN1B, a candidate tumor-suppressor gene, in refractory secondary/tertiary hyperparathyroidism.
18285702 2008 Jun activation domain-binding protein 1 negatively regulate p27 kip1 in non-Hodgkin's lymphomas.
18281541 2008 Effects of common germ-line genetic variation in cell cycle genes on ovarian cancer survival.
18281517 2008 Induction of growth arrest and apoptosis in human breast cancer cells by 3,3-diindolylmethane is associated with induction and nuclear localization of p27kip.
18272788 2008 Formation of E-cadherin/beta-catenin-based adherens junctions in hepatocytes requires serine-10 in p27(Kip1).
18246793 2007 [Expression and relationship of p27(kip1) and its related molecules Jab1 and CRM1 during proliferation of lymphoma cells U937].
18226337 2008 [Expression of survivin, p27 and PTEN in hepatocellular carcinoma and their clinical significances].
18222429 2008 Increased messenger ribonucleic acid expression of the cyclin-dependent kinase inhibitor p27Kip1 in cleavage-stage human embryos exhibiting developmental arrest.
18203777 2008 Expression of p21Cip1/Waf1 and p27Kip1 in small cell neuroendocrine carcinoma of the uterine cervix.
18202760 2008 Rare sugar D-allose induces specific up-regulation of TXNIP and subsequent G1 cell cycle arrest in hepatocellular carcinoma cells by stabilization of p27kip1.
18181833 2008 Expression of cell cycle inhibitors p21, p27, p14 and p16 in gliomas. Correlation with classic prognostic factors and patients' outcome.
18180298 2008 Alternate cyclin D1 mRNA splicing modulates p27KIP1 binding and cell migration.
18177895 2008 Role of intrinsic flexibility in signal transduction mediated by the cell cycle regulator, p27 Kip1.
18174243 2008 Association of single-nucleotide polymorphisms in the cell cycle genes with breast cancer in the British population.
18156402 2008 Inhibition of cell cycle progression by hydroxytyrosol is associated with upregulation of cyclin-dependent protein kinase inhibitors p21(WAF1/Cip1) and p27(Kip1) and with induction of differentiation in HL60 cells.
18154709 2007 [p27Kip1: tumor suppressor and oncogene?].
18095123 2006 Prognostic implication of p27 expression in primary central nervous system lymphoma.
18089324 2007 A clinicopathologic study of p27(kip1) expression in renal allograft biopsy.
18073348 2008 Haploinsufficiency of CDKN1B contributes to leukemogenesis in T-cell prolymphocytic leukemia.
18037997 2007 PKCtheta promotes c-Rel-driven mammary tumorigenesis in mice and humans by repressing estrogen receptor alpha synthesis.
18036045 2007 Overexpression of p27kip1 in urinary bladder urothelial carcinoma.
18032931 2007 Loss of p27 expression through RAS-->BRAF-->MAP kinase-dependent pathway in human thyroid carcinomas.
18027257 2007 Reduced expression of p16 and p27 is correlated with tumour progression in cutaneous melanoma.
18006823 2007 Pirh2 promotes ubiquitin-dependent degradation of the cyclin-dependent kinase inhibitor p27Kip1.
17974156 2006 Cyclin dependent kinase inhibitor p27(kip1) expression and subcellular localization in relation to cell proliferation in hepatocellualr carcinoma.
17974037 2007 Effect of hypoxia and Beraprost sodium on human pulmonary arterial smooth muscle cell proliferation: the role of p27kip1.
17927588 2007 HER-2/neu and p27Kip1 in progression of Fallopian tube carcinoma: an immunohistochemical and array comparative genomic hybridization study.
17914108 2007 MicroRNAs (miR)-221 and miR-222, both overexpressed in human thyroid papillary carcinomas, regulate p27Kip1 protein levels and cell cycle.
17908995 2007 Genetic variants in cell cycle control pathway confer susceptibility to lung cancer.
17854759 2007 Cell cycle-dependent caspase-like activity that cleaves p27(KIP1) is the beta(1) subunit of the 20S proteasome.
17851288 2007 Heterogeneous p27(Kip1) expression within primary renal cell cancers, their invasive margins and peritumoral renal parenchyma correlation with pathological and prognostic features.
17804714 2007 Genetic screening reveals an essential role of p27kip1 in restriction of breast cancer progression.
17803708 2008 Evaluation of CDKN2C/p18, CDKN1B/p27 and CDKN2B/p15 mRNA expression, and CpG methylation status in sporadic and MEN1-associated pancreatic endocrine tumours.
17721077 2007 Regulation of p27Kip1 by miRNA 221/222 in glioblastoma.
17710155 2007 Mutational analysis of p27 (CDKN1B) and p18 (CDKN2C) in sporadic pancreatic endocrine tumors argues against tumor-suppressor function.
17695524 Alterations of the p53, Rb and p27 tumor suppressor pathways in diffuse large B-cell lymphomas.
17692879 2007 A crystalline compound (BM-ANF1) from the Indian toad (Bufo melanostictus, Schneider) skin extract, induced antiproliferation and apoptosis in leukemic and hepatoma cell line involving cell cycle proteins.
17685465 2007 BRAF V600E mutation and p27 kip1 expression in papillary carcinomas of the thyroid <or=1 cm and their paired lymph node metastases.
17671428 2007 Spy1 enhances phosphorylation and degradation of the cell cycle inhibitor p27.
17651785 2007 Inverse expression of Jun activation domain binding protein 1 and cell cycle inhibitor p27Kip1: influence on proliferation in hepatocellular carcinoma.
17627278 2007 Regulation of the p27(Kip1) tumor suppressor by miR-221 and miR-222 promotes cancer cell proliferation.
17613551 2007 Susceptibility to pituitary neoplasia related to MEN-1, CDKN1B and AIP mutations: an update.
17611557 2007 Pleiotropic p27(Kip1), BCR-ABL and leukemic stem cell: the trio in concert.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17586698 2007 Neutrophil elastase inhibition of cell cycle progression in airway epithelial cells in vitro is mediated by p27kip1.
17581405 2007 Clinical significance of p27 and Skp2 protein expression in uterine cervical neoplasm.
17567920 2007 Polymorphisms cMyc-N11S and p27-V109G and breast cancer risk and prognosis.
17560996 2007 Notch signaling induces SKP2 expression and promotes reduction of p27Kip1 in T-cell acute lymphoblastic leukemia cell lines.
17554557 2007 Human pheochromocytomas show reduced p27Kip1 expression that is not associated with somatic gene mutations and rarely with deletions.
17553787 2007 The cyclin-dependent kinase inhibitors p15INK4B and p21CIP1 are critical regulators of fibrillar collagen-induced tumor cell cycle arrest.
17550142 2007 P27 V109G Polymorphism is associated with lymph node metastases but not with increased risk of breast cancer.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17519308 2007 Germline CDKN1B/p27Kip1 mutation in multiple endocrine neoplasia.
17502456 2007 Cell adhesion induces p27Kip1-associated cell-cycle arrest through down-regulation of the SCFSkp2 ubiquitin ligase pathway in mantle-cell and other non-Hodgkin B-cell lymphomas.
17470459 2007 p27Kip1 localization depends on the tumor suppressor protein tuberin.
17464290 2007 Myc targets Cks1 to provoke the suppression of p27Kip1, proliferation and lymphomagenesis.
17448572 2008 Enhanced proteasome-dependent degradation of the CDK inhibitor p27(kip1) in immortalized lymphocytes from Alzheimer's dementia patients.
17418410 2007 HIF-2alpha promotes hypoxic cell proliferation by enhancing c-myc transcriptional activity.
17409409 2007 Tagging single nucleotide polymorphisms in cell cycle control genes and susceptibility to invasive epithelial ovarian cancer.
17407140 2007 Overexpression of integrin beta1 inhibits proliferation of hepatocellular carcinoma cell SMMC-7721 through preventing Skp2-dependent degradation of p27 via PI3K pathway.
17404436 2007 Down-regulation of p27(Kip 1) cyclin-dependent kinase inhibitor in prostate cancer: distinct expression in various prostate cells associating with tumor stage and grades.
17404431 2007 Prognostic significance of p27(Kip 1) expression in renal cell carcinoma.
17372254 2007 Epistatic relationship between the cancer susceptibility genes CHEK2 and p27.
17357515 2006 [The clinical significance of molecular findings in surgically resected margins of the primary tumor laryngeal carcinoma].
17319789 2007 A molecularly genetic determination of prognostic factors of the prostate cancer and their relationships to expression of protein p27kip1.
17316413 2007 p27KIP-1, cyclin A and cyclin D1 protein expression in ductal carcinoma in situ of the breast: p27KIP-1 correlates with hormone receptor status but not with local recurrence.
17311291 2007 In vitro differentiation of HT-29 M6 mucus-secreting colon cancer cells involves a trychostatin A and p27(KIP1)-inducible transcriptional program of gene expression.
17303695 2007 CKS1B, overexpressed in aggressive disease, regulates multiple myeloma growth and survival through SKP2- and p27Kip1-dependent and -independent mechanisms.
17285761 2006 Analysis of p27KIP1 protein and Ki-67 expression in aggressive fibromatosis (desmoid tumor).
17254967 2007 p27 phosphorylation by Src regulates inhibition of cyclin E-Cdk2.
17254966 2007 Cdk-inhibitory activity and stability of p27Kip1 are directly regulated by oncogenic tyrosine kinases.
17239930 2007 Cytoplasmic localization of p27 (cyclin-dependent kinase inhibitor 1B/KIP1) in colorectal cancer: inverse correlations with nuclear p27 loss, microsatellite instability, and CpG island methylator phenotype.
17237771 2007 The energy sensing LKB1-AMPK pathway regulates p27(kip1) phosphorylation mediating the decision to enter autophagy or apoptosis.
17216128 2007 Association of LKB1 with a WD-repeat protein WDR6 is implicated in cell growth arrest and p27(Kip1) induction.
17203174 2007 Cell cycle regulating proteins p21 and p27 in prognosis of oral squamous cell carcinomas.
17188136 2006 Patterns of expression of cell cycle/apoptosis genes along the spectrum of thyroid carcinoma progression.
17178856 2006 Up-regulation of GPR48 induced by down-regulation of p27Kip1 enhances carcinoma cell invasiveness and metastasis.
17148774 2006 p27(Kip1) and cyclin E expression and breast cancer survival after treatment with adjuvant chemotherapy.
17123889 2006 Loss of p27 expression and microsatellite instability in sporadic colorectal cancer.
17072952 2006 Cytoplasmic expression of p27(kip1) is associated with a favourable prognosis in colorectal cancer patients.
17072949 2006 p21 and p27 immunoexpression in gastric well differentiated endocrine tumors (ECL-cell carcinoids).
17053782 2006 C-terminal phosphorylation controls the stability and function of p27kip1.
17030811 2006 Germ-line mutations in p27Kip1 cause a multiple endocrine neoplasia syndrome in rats and humans.
17013388 2006 A pathway regulated by cell cycle inhibitor p27Kip1 and checkpoint inhibitor Smad3 is involved in the induction of T cell tolerance.
17008550 2007 Promoter SNPs in G1/S checkpoint regulators and their impact on the susceptibility to childhood leukemia.
16966613 2006 Testing the importance of p27 degradation by the SCFskp2 pathway in murine models of lung and colon cancer.
16951171 2006 Potential role of Jun activation domain-binding protein 1 as a negative regulator of p27kip1 in pancreatic adenocarcinoma.
16939421 2007 HBx-dependent cell cycle deregulation involves interaction with cyclin E/A-cdk2 complex and destabilization of p27Kip1.
16880511 2006 Regulation of p27 degradation and S-phase progression by Ro52 RING finger protein.
16842750 2006 Mutations of phosphorylation sites Ser10 and Thr187 of p27Kip1 abolish cytoplasmic redistribution but do not abrogate G0/1 phase arrest in the HepG2 cell line.
16835890 2006 PC3, but not DU145, human prostate cancer cells retain the coregulators required for tumor suppressor ability of androgen receptor.
16804901 2006 Variant genotypes of CDKN1A and CDKN1B are associated with an increased risk of breast cancer in Chinese women.
16782892 2006 Regulated activating Thr172 phosphorylation of cyclin-dependent kinase 4(CDK4): its relationship with cyclins and CDK "inhibitors".
16705171 2006 Focal adhesion kinase controls cellular levels of p27/Kip1 and p21/Cip1 through Skp2-dependent and -independent mechanisms.
16636894 2006 Prognostic impact of Skp2 and p27 in human breast cancer.
16598766 2006 p27kip1 overexpression promotes paclitaxel-induced apoptosis in pRb-defective SaOs-2 cells.
16537899 2006 Cul4A and DDB1 associate with Skp2 to target p27Kip1 for proteolysis involving the COP9 signalosome.
16532026 2006 Negative cell cycle regulator 14-3-3sigma stabilizes p27 Kip1 by inhibiting the activity of PKB/Akt.
16526056 2006 Mutational analysis of the cell cycle inhibitor Kip1/p27 in childhood leukemia.
16480585 2006 [Association of polymorphisms of p21cip1 and p27kip1 genes with susceptibilities of esophageal squamous cell carcinoma and gastric cardiac adenocarcinoma].
16474380 2006 Expression of the CDK inhibitor p27kip1 and oxidative DNA damage in non-neoplastic and neoplastic vulvar epithelial lesions.
16465393 2006 Expression of cdc2 and p27(KIP1) phosphorylation in mitotic cells of the human retinoblastoma.
16463785 2005 [Expression and significance of Skp2 and p27kip1 protein in pathological scar].
16458085 2006 Thermodynamic characterization of interactions between p27(Kip1) and activated and non-activated Cdk2: intrinsically unstructured proteins as thermodynamic tethers.
16425372 2005 Relation of overexpression of S phase kinase-associated protein 2 with reduced expression of p27 and PTEN in human gastric carcinoma.
16407831 2006 TIMP-1 regulation of cell cycle in human breast epithelial cells via stabilization of p27(KIP1) protein.
16398674 2006 Bottom-up cell proliferation with cyclin A and p27Kip1 expression in ulcerative colitis-associated dysplasia.
16391524 2005 Bis induces growth inhibition and differentiation of HL-60 cells via up-regulation of p27.
16381901 2006 The LIFEdb database in 2006.
16365885 2006 Modified p27 Kip1 is efficient in suppressing HER2-mediated tumorigenicity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16326706 2006 Shp-1 mediates the antiproliferative activity of tissue inhibitor of metalloproteinase-2 in human microvascular endothelial cells.
16322693 2006 Involvement of CUL4 ubiquitin E3 ligases in regulating CDK inhibitors Dacapo/p27Kip1 and cyclin E degradation.
16300740 2006 Interaction of the stress protein p8 with Jab1 is required for Jab1-dependent p27 nuclear-to-cytoplasm translocation.
16289477 2005 The cell cycle regulator p27Kip1 interacts with MCM7, a DNA replication licensing factor, to inhibit initiation of DNA replication.
16283443 2005 Aggressive vestibular schwannomas showing postoperative rapid growth - their association with decreased p27 expression.
16273250 2005 Cell-cycle-associated markers and clinical outcome in human epithelial cancers: a tissue microarray study.
16254341 2005 Induction of cell cycle arrest by human T-cell lymphotropic virus type 1 Tax in hematopoietic progenitor (CD34+) cells: modulation of p21cip1/waf1 and p27kip1 expression.
16209941 2005 Structural basis of the Cks1-dependent recognition of p27(Kip1) by the SCF(Skp2) ubiquitin ligase.
16195327 2006 Tyrosine phosphorylation modulates binding preference to cyclin-dependent kinases and subcellular localization of p27Kip1 in the acute promyelocytic leukemia cell line NB4.
16194892 2005 PTEN and p27 expression in mature T-cell and NK-cell neoplasms.
16191374 2005 [Expression of p21WAF1, p27KIP1 and cyclin E in ameloblastoma].
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16135812 2005 Pathway- and expression level-dependent effects of oncogenic N-Ras: p27(Kip1) mislocalization by the Ral-GEF pathway and Erk-mediated interference with Smad signaling.
16123592 2005 The acidic tail domain of human Cdc34 is required for p27Kip1 ubiquitination and complementation of a cdc34 temperature sensitive yeast strain.
16097446 p27(kip1) and Ki-67 (MIB1) immunohistochemical expression in radical prostatectomy specimens of patients with clinically localized prostate cancer.
16086840 2005 Expression of transforming growth factor-beta-1 and p27Kip1 in pancreatic adenocarcinomas: relation with cell-cycle-associated proteins and clinicopathologic characteristics.
16052694 2005 Expression and hypermethylation of p27 kip1 in hepatocarcinogenesis.
16035731 2005 Molecular analysis of the p27/kip1 gene in breast cancer.
16024059 2005 Relationship between levels of Skp2 and P27 in breast carcinomas and possible role of Skp2 as targeted therapy.
16023837 2005 The CDK inhibitor p27 enhances neural differentiation in pluripotent NTERA2 human EC cells, but does not permit differentiation of 2102Ep nullipotent human EC cells.
16022660 2005 p27(kip1) functional regulation in human cancer: a potential target for therapeutic designs.
16019539 2005 Natural killer cell lymphoma/leukemia with homozygous loss of p27/kip1.
16012758 2005 Phosphorylation of p27(KIP1) in the developing retina and retinoblastoma.
16007079 2005 Cdc2-cyclin E complexes regulate the G1/S phase transition.
16006622 2005 Regulation of expression by promoters versus internal ribosome entry site in the 5'-untranslated sequence of the human cyclin-dependent kinase inhibitor p27kip1.
15996662 2005 Inducible expression of a degradation-resistant form of p27Kip1 causes growth arrest and apoptosis in breast cancer cells.
15963850 2005 Oncogenic Ras blocks transforming growth factor-beta-induced cell-cycle arrest by degradation of p27 through a MEK/Erk/SKP2-dependent pathway.
15936816 2005 Absence of p21(CIP 1), p27(KIP 1) and p 57(KIP 2) methylation in MDS and AML.
15924242 2005 Effect of the cyclin-dependent kinases inhibitor p27 on resistance of ovarian cancer multicellular spheroids to anticancer chemotherapy.
15890360 2005 Molecular basis for the specificity of p27 toward cyclin-dependent kinases that regulate cell division.
15833859 2005 BCR-ABL induces the expression of Skp2 through the PI3K pathway to promote p27Kip1 degradation and proliferation of chronic myelogenous leukemia cells.
15813917 2005 Methylation status analysis of cell cycle regulatory genes (p16INK4A, p15INK4B, p21Waf1/Cip1, p27Kip1 and p73) in natural killer cell disorders.
15798096 2005 The progression of LNCaP human prostate cancer cells to androgen independence involves decreased FOXO3a expression and reduced p27KIP1 promoter transactivation.
15777850 2005 TGF-beta1-mediated activations of c-Src and Rac1 modulate levels of cyclins and p27(Kip1) CDK inhibitor in hepatoma cells replated on fibronectin.
15746092 2005 p21Cip1 and p27Kip1 induce distinct cell cycle effects and differentiation programs in myeloid leukemia cells.
15743786 2005 Complex regulation of the cyclin-dependent kinase inhibitor p27kip1 in thyroid cancer cells by the PI3K/AKT pathway: regulation of p27kip1 expression and localization.
15736055 2005 Expression of Skp2 and p27KIP1 in naevi and malignant melanoma of the skin and its relation to clinical outcome.
15722793 2005 Prognostic significance of DCC and p27Kip1 in colorectal cancer.
15718252 2005 Reduced E-cadherin expression contributes to the loss of p27kip1-mediated mechanism of contact inhibition in thyroid anaplastic carcinomas.
15713665 2005 Activation of p27Kip1 Expression by E2F1. A negative feedback mechanism.
15710386 2005 IFN-gamma/IRF-1-induced p27kip1 down-regulates telomerase activity and human telomerase reverse transcriptase expression in human cervical cancer.
15708847 2005 The tumor-specific hyperactive forms of cyclin E are resistant to inhibition by p21 and p27.
15701850 2005 Subcellular localization of p27kip1 expression predicts poor prognosis in human ovarian cancer.
15688030 2005 Constitutively active FOXO4 inhibits Akt activity, regulates p27 Kip1 stability, and suppresses HER2-mediated tumorigenicity.
15688004 2005 Activation of FoxO transcription factors contributes to the antiproliferative effect of cAMP.
15652749 2005 p27(Kip1)-stathmin interaction influences sarcoma cell migration and invasion.
15652359 2005 The human ubiquitin-conjugating enzyme Cdc34 controls cellular proliferation through regulation of p27Kip1 protein levels.
15647380 2005 p27Kip1 acts downstream of N-cadherin-mediated cell adhesion to promote myogenesis beyond cell cycle regulation.
15645120 2005 Promotion of cell differentiation, and suppression of cell growth and cyclooxygenase-2 expression by differentiation-inducing agents in human oral squamous carcinoma SCC25 cells.
15627896 The V109G polymorphism of the p27 gene CDKN1B indicates a worse outcome in node-negative breast cancer patients.
15611642 2005 HER2-targeting antibodies modulate the cyclin-dependent kinase inhibitor p27Kip1 via multiple signaling pathways.
15605273 2005 Downregulation of Skp2 and p27/Kip1 synergistically induces apoptosis in T98G glioblastoma cells.
15592362 2005 TNFalpha resistance in MCF-7 breast cancer cells is associated with altered subcellular localization of p21CIP1 and p27KIP1.
15583032 2004 Terminal osteoblast differentiation, mediated by runx2 and p27KIP1, is disrupted in osteosarcoma.
15579505 2004 Oxidized LDL induces proliferation and hypertrophy in human umbilical vein endothelial cells via regulation of p27Kip1 expression: role of RhoA.
15579463 2005 Phosphorylation of p27Kip1 at Thr-157 interferes with its association with importin alpha during G1 and prevents nuclear re-entry.
15492811 2004 Expression of p27 and MAPK proteins involved in all-trans retinoic acid-induced apoptosis and cell cycle arrest in matched primary and metastatic melanoma cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15480426 2004 Thioredoxin modulates activator protein 1 (AP-1) activity and p27Kip1 degradation through direct interaction with Jab1.
15475071 2004 Methylation status of cyclin-dependent kinase inhibitor genes within the transforming growth factor beta pathway in human T-cell lymphoblastic lymphoma/leukemia.
15469821 2004 An Rb-Skp2-p27 pathway mediates acute cell cycle inhibition by Rb and is retained in a partial-penetrance Rb mutant.
15457580 2004 Mad2 and p27 expression profiles in colorectal cancer and its clinical significance.
15378017 2004 Different cooperating effect of p21 or p27 deficiency in combination with INK4a/ARF deletion in mice.
15374880 2005 Inhibition of Akt increases p27Kip1 levels and induces cell cycle arrest in anaplastic large cell lymphoma.
15358549 2004 Facilitation of proteasomal degradation of p27Kip1 by N-terminal cleavage and their sequence requirements.
15355997 2004 Tuberin binds p27 and negatively regulates its interaction with the SCF component Skp2.
15352609 2004 Application of p27 gene therapy for human malignant glioma potentiated by using mutant p27.
15314639 2004 Abnormalities of apoptotic and cell cycle regulatory proteins in distinct histopathologic components of benign prostatic hyperplasia.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15289327 2004 Cytoplasmic mislocalization of p27Kip1 protein is associated with constitutive phosphorylation of Akt or protein kinase B and poor prognosis in acute myelogenous leukemia.
15280662 2004 Akt-dependent T198 phosphorylation of cyclin-dependent kinase inhibitor p27kip1 in breast cancer.
15271792 2004 KSHV viral cyclin binds to p27KIP1 in primary effusion lymphomas.
15239677 2004 Hypoxia regulation of the cell cycle in malignant melanoma: putative role for the cyclin-dependent kinase inhibitor p27.
15217930 2004 Association between the V109G polymorphism of the p27 gene and the risk and progression of oral squamous cell carcinoma.
15199159 2004 Noncatalytic requirement for cyclin A-cdk2 in p27 turnover.
15188025 2004 Significantly decreased P27 expression in endometrial carcinoma compared to complex hyperplasia with atypia (correlation with p53 expression).
15170516 2004 Increased apoptosis in differentiating p27-deficient mouse embryonic stem cells.
15161709 2004 pRb2/p130, vascular endothelial growth factor, p27(KIP1), and proliferating cell nuclear antigen expression in hepatocellular carcinoma: their clinical significance.
15154004 2004 Expression of cell cycle inhibitor p27Kip1 and its inactivator Jab1 in melanocytic lesions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15133847 2004 Expression and altered subcellular localization of the cyclin-dependent kinase inhibitor p27Kip1 in hepatocellular carcinoma.
15096506 2004 Role of RhoA, mDia, and ROCK in cell shape-dependent control of the Skp2-p27kip1 pathway and the G1/S transition.
15064717 2004 Vitamin D3 receptor/Sp1 complex is required for the induction of p27Kip1 expression by vitamin D3.
15061869 2004 A single-nucleotide polymorphism in the human p27kip1 gene (-838C>A) affects basal promoter activity and the risk of myocardial infarction.
15060836 2004 Immunohistochemical expression of cyclin D1, cyclin E, p21/waf1 and p27/kip1 in inflammatory bowel disease: correlation with other cell-cycle-related proteins (Rb, p53, ki-67 and PCNA) and clinicopathological features.
15057270 2004 14-3-3 suppresses the nuclear localization of threonine 157-phosphorylated p27(Kip1).
15034923 2004 Cell cycle regulatory protein p27KIP1 is a substrate and interacts with the protein kinase CK2.
15026335 2004 A polymorphism in the CDKN1B gene is associated with increased risk of hereditary prostate cancer.
15024385 2004 p27 binds cyclin-CDK complexes through a sequential mechanism involving binding-induced protein folding.
15014027 2004 Prognostic significance of p27(kip-1) expression in colorectal adenocarcinomas is associated with tumor stage.
14984940 2004 Decreased expression of the CDK inhibitor p27Kip1 and increased oxidative DNA damage in the multistep process of cervical carcinogenesis.
14871979 2004 The prognostic and therapeutic relevance of p27kip1 in Ewing's family tumors.
14760081 2004 MIB-1 (KI-67) proliferation index and cyclin-dependent kinase inhibitor p27(Kip1) protein expression in nephroblastoma.
14747563 2004 Epstein-Barr virus nuclear antigen 3C regulates cyclin A/p27 complexes and enhances cyclin A-dependent kinase activity.
14719054 2004 Prognostic significance of localized p27Kip1 and potential role of Jab1/CSN5 in pancreatic cancer.
14707458 2003 Loss of p27 expression is associated with poor prognosis in stage I-II pancreatic cancer.
14707456 2003 Skp2 and Jab1 expression are associated with inverse expression of p27(KIP1) and poor prognosis in oral squamous cell carcinomas.
14694185 2004 End-stage differentiation of neutrophil granulocytes in vivo is accompanied by up-regulation of p27kip1 and down-regulation of CDK2, CDK4, and CDK6.
14666612 Jun activation domain-binding protein 1 expression in malignant lymphoma of the thyroid: its linkage to degree of malignancy and p27 expression.
14654548 2003 Jun activation domain binding protein 1 expression is associated with low p27(Kip1)levels in node-negative breast cancer.
14614018 2003 Frequent loss of expression of the cyclin-dependent kinase inhibitor p27(Kip1) in estrogen-related Endometrial adenocarcinomas.
14612944 2003 Down-regulation of telomerase activity in malignant glioma cells by p27KIP1.
14606065 2003 Inhibition of adenovirus-mediated p27kip1 gene on growth of esophageal carcinoma cell strain.
14586408 2003 TGF-beta-induced apoptosis in human thyrocytes is mediated by p27kip1 reduction and is overridden in neoplastic thyrocytes by NF-kappaB activation.
14573608 2004 Rapamycin-resistant proliferation of CD8+ T cells correlates with p27kip1 down-regulation and bcl-xL induction, and is prevented by an inhibitor of phosphoinositide 3-kinase activity.
14558671 2002 The expression of the F-box protein Skp2 is negatively associated with p27 expression in human pituitary tumors.
14534684 Expression of the tumor suppressor gene PTEN is not altered in the progression of ovarian carcinomas and does not correlate with p27Kip1 expression.
14517080 2003 HCV core/gC1qR interaction arrests T cell cycle progression through stabilization of the cell cycle inhibitor p27Kip1.
14504289 2003 Phosphorylation of p27Kip1 at threonine 198 by p90 ribosomal protein S6 kinases promotes its binding to 14-3-3 and cytoplasmic localization.
12972555 2003 Spy1 interacts with p27Kip1 to allow G1/S progression.
12963837 The role of p27Kip1 in proteasome inhibitor induced apoptosis.
12954644 2003 Vitamin D inhibits G1 to S progression in LNCaP prostate cancer cells through p27Kip1 stabilization and Cdk2 mislocalization to the cytoplasm.
12904306 2003 Estrogens down-regulate p27Kip1 in breast cancer cells through Skp2 and through nuclear export mediated by the ERK pathway.
12883474 2003 Mechanism of beta 1-integrin-mediated hepatoma cell growth involves p27 and S-phase kinase-associated protein 2.
12882323 2003 Increased p27, an essential component of cell cycle control, in Alzheimer's disease.
12860294 2003 14-3-3 sigma possibly plays a constitutive role in papillary carcinoma, but not in follicular tumor of the thyroid.
12850001 2003 Accumulation of p27 KIP1 is associated with BMP2-induced growth arrest and neuronal differentiation of human neuroblastoma-derived cell lines.
12837699 2003 Cell cycle-dependent translation of p27 involves a responsive element in its 5'-UTR that overlaps with a uORF.
12824885 2003 The prognosis in spindle-cell sarcoma depends on the expression of cyclin-dependent kinase inhibitor p27(Kip1) and cyclin E.
12820381 Expression of p27 and apoptosis in oral leukoplakia.
12813041 2003 A negatively charged amino acid in Skp2 is required for Skp2-Cks1 interaction and ubiquitination of p27Kip1.
12809895 2003 Predicting biochemical recurrence after radical prostatectomy for patients with organ-confined disease using p27 expression.
12777997 2003 p27 and cyclin E/D2 associations in testicular germ cell tumors: implications for tumorigenesis.
12771291 2003 Parathyroid cell growth in patients with advanced secondary hyperparathyroidism: vitamin D receptor and cyclin-dependent kinase inhibitors, p21 and p27.
12748192 2003 Phosphorylation of threonine 10 on CKBBP1/SAG/ROC2/Rbx2 by protein kinase CKII promotes the degradation of IkappaBalpha and p27Kip1.
12727815 2003 CDKN1A and CDKN1B polymorphisms and risk of advanced prostate carcinoma.
12700629 2003 Inducible p27(Kip1) expression inhibits proliferation of K562 cells and protects against apoptosis induction by proteasome inhibitors.
12698196 2003 Antitumour effect