Property Summary

NCBI Gene PubMed Count 1,259
PubMed Score 2997.37
PubTator Score 3747.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer -1.100 1.1e-02
malignant mesothelioma -2.200 2.2e-08
oligodendroglioma 1.300 4.8e-03
glioblastoma 2.500 6.7e-04
osteosarcoma 1.333 1.9e-02
astrocytoma 2.000 2.9e-02
non diabetic and post-ischemic heart fai... -1.200 8.2e-03
type II diabetes mellitus and post-ische... -1.200 3.5e-02
medulloblastoma, large-cell -1.300 6.2e-03
Duchenne muscular dystrophy 1.069 9.9e-06
autosomal dominant Emery-Dreifuss muscul... 1.883 7.3e-04
juvenile dermatomyositis 1.407 5.7e-08
acute quadriplegic myopathy 2.940 1.3e-09
limb girdle muscular dystrophy 2A 1.087 1.8e-04
tuberculosis -1.300 2.4e-02
primary pancreatic ductal adenocarcinoma 1.172 1.9e-02
lung cancer -3.100 1.2e-06
subependymal giant cell astrocytoma 2.595 3.7e-03
psoriasis -1.100 2.8e-06
ductal carcinoma in situ 1.200 3.1e-02
ovarian cancer 1.200 5.5e-03
pituitary cancer -2.300 5.5e-06

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
463170 screening 0 / 0 / 2 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of Wee1 degradation: luminescence-based cell-based assay to identify inhibitors of p21 (CDKN1A) degradation

Gene RIF (1196)

PMID Text
27156331 demonstrated that patients with the LMP-7 CA/AA genotypes were more likely to have advanced fibrosis scores than those bearing the CC genotype
27012093 these results demonstrate complex links between different signaling cascades in stressed hMESC, implicating ERK, p38 and JNK in regulation of the premature senescence via p53/p21/Rb pathway.
26986513 NORE1A expression appeared to contribute to mCD40L-induced cell death and enhance cell transition from G1 to S phase of the cell cycle in a p21-dependent mechanism.
26970274 prolactin activation of Stat5 results in the formation of a complex between phospho-Stat5 and BRCA1. Formation of this complex does not interfere with nuclear translocation or binding of BRCA1 to the p21 promoter
26940882 Estrogen-related receptor gamma is upregulated in liver cancer and its inhibition suppresses liver cancer cell proliferation via induction of p21 and p27.
26876176 Dynamics of CDKN1A in single cells has been defined defined by an endogenous fluorescent tagging.
26861625 Foxo3 circular RNA retards cell cycle progression via forming ternary complexes with p21 and CDK2.
26832959 It was concluded that over-activation of the mTORC1/4E-BP1/p21 pathway is a frequent and clinically relevant alteration in head and neck squamous cell carcinomas.
26823785 results suggested that high CDKN1A/p21 and low TGFBR2 expression was closely correlated with adverse pathological parameters and poor prognosis in breast cancer.
26754670 Study provides evidence that miR-208a can affect the proliferation and radio-sensitivity of human lung cancer cells by targeting p21.
26740620 Data suggest that cell cycle-dependent kinase inhibitors CDKN1A/p21 and CDKN2C/p18 facilitate cell cycle entry/cell proliferation of quiescent adult human pancreatic beta cells in primary culture (from tissues obtained from organ donors).
26730949 Data show that interaction of cyclin-dependent kinase inhibitor 1A (p21 Cip1) with poly(ADP-ribose) polymerase-1 (PARP-1) is mediated by poly(ADP-ribose) (PAR).
26713361 These data collectively suggest a novel mechanism involving CSLC-specific targeting by evodiamine and its possible use to the therapy of breast cancer.
26687534 These findings demonstrated that p21 plays a critical role in furazolidone-induced apoptosis in HepG2 cells by influencing the caspase-3 activation and ROS generation.
26677902 Clioquinol suppressed cell cycle progression in the S-phase in SMMC-7721 hepatoma cells via the p21, p27-cyclin E,A/Cdk2 pathway.
26659654 tumor suppressive function of HPCAL1 was dependent on p21 in hepatocellular carcinoma
26648284 Overexpression of miR-512-5p led to the decrease of p21 protein.
26600172 These results suggest that p21(Waf1/CIP1) and Hus1 play crucial roles in the generation and transmission of bystander damage signals after low-dose alpha-particle irradiation.
26595675 Suggest that the p53-p21-DREAM-CDE/CHR pathway regulates p53-dependent repression of Survivin, CDC25C, and PLK1 in HCT116 cells.
26572940 accumulation of HDAC4 induced by fibrillar collagen matrices in the nucleus via co-localization of PP1alpha, leads to repression of the mRNA/protein of p21 and in turn promotes the proliferation and migration of epithelial ovarian cancer cells
26546411 p21 may function as a regulator of transcriptional factors other than the inhibitor of cell cycle progression in the cartilage tissue
26506264 p21WAF1 regulates the early stages of drug-induced apoptosis in B-cell precursor acute lymphoblastic leukemia cells and significantly modulates their sensitivity to vorinostat.
26486079 Data show CGK733 induced microtubule associated protein LC3B formation upstream of AMP-activated protein kinase and protein kinase RNA-like endoplasmic reticulum kinase/CCAAT-enhancer-binding protein homologous protein pathways and p21 Cip1 expression.
26436589 PRMT6 methylates tumor cell p21 at arginine 156 and promotes phosphorylation of threonine 145 on p21, increasing the cytoplasmic localization of p21 and inducing resistance to anticancer drugs.
26402653 Data showed that miR-423 was up-regulated in colorectal cancer (CRC) tissues promoting cell proliferation. Cip1 mediated the function of miR-423, and its overexpression reversed the augmented effect of miR-423 on cell proliferation.
26400164 LRH-1 drives colon cancer cell growth by repressing the expression of the CDKN1A gene in a p53-dependent manner.
26384650 Phosphorylation of p53 by LRRK2 induces p21(WAF1/CIP1) expression and apoptosis.
26384566 downregulation of these genes through the p53-p21-DREAM-CDE/CHR pathway appears to be a principal mechanism for G2/M cell cycle arrest by p53.
26384350 Data suggest that HOXA-AS2 could be an oncogene for GC partly through suppressing P21, PLK3, and DDIT3 expression.
26352014 Plk3 is involved in the inhibition of cell proliferation and tumorigenesis, which may occur via interactions with p21.
26340092 INO80 complex negatively regulates p21 expression in a p53-mediated mechanism and is implicated in cell cycle phase G2/M arrest and abnormal chromosome stability.
26335183 Data show that all the chelators up-regulated cyclin dependent kinase inhibitor 1A (p21/CIP1/WAF1) mRNA in the five tumor cell-types, but either upregulated or downregulated total p21 protein levels.
26289323 This case-control study was designed to analyse the association Single nucleotide polymorphisms (SNPs) of p53 rs1042522, MDM2 rs2279744 and p21 rs1801270 and retinoblastoma (RB) in a Chinese Han population.
26278624 The rs1059234 C > T polymorphism was associated with increased risk of squamous cell carcinoma of the head and neck (SCCHN.)
26238857 These observations illustrated that miR-106b could induce cell radioresistance by directly targeting PTEN and p21.
26231799 This study indicated that miR-4295 negatively regulates CDKN1A and promotes proliferation and invasion of ATC cell lines. Thus, miR-4295 may represent a potential therapeutic target for ATC intervention.
26223645 Results demonstrate an antagonistic relationship between pUL27 and pUL97 activities centering on the host p21Cip1.
26217035 JunB is likely to be a key target of c-Abl in expression of p21 in Adriamycin-induced DDR.
26212257 Data indicate that resveratrol plus curcumin inhibits Hedgehog-Gli1 components in p21Waf1/Cip1 dependent manner.
26203195 NGP-1 promotes cell cycle progression through the activation of the p53/p21(Cip-1/Waf1) pathway.
26199387 These findings point to (i) the relevance of CS-related mechanisms in Hodgkin lymphoma , and to (ii) the prognostic value of a simple, reproducible, and low-cost immunohistochemical evaluation of p16(INK4a) and p21(CIP1/WAF1) expression.
26191193 Low p21 expression predicated tumor recurrence and poor prognosis in bladder cancer.
26187313 Blocking TGFBR1 receptor up-regulated p21 expression while inhibiting breast tumor cell growth.
26177745 UTD1, a genetically engineered epothilone analog and a new microtubule inhibitor, activated p53 as a transcription factor at low concentrations demonstrated by its enhanced transcriptional activity and accumulation of p21, which led to cell cycle arrest
26171916 Combined immunohistochemistry of PLK1, p21, and p53 can predict the TP53 status of breast cancer patients.
26151768 In G28 cells, a dosedependent induction of CDK2, p21 and cyclin D was observed between 10 and 50 microM roscovitine after 72 h, however, at the highest concentration of 100 microM, all investigated genes were downregulated.
26149128 Neisseria meningitidis caused changes in the abundance of several cell cycle regulatory mRNAs, including the cell cycle inhibitors p21(WAF1/CIP1) and cyclin G2 in human brain microvascular endothelial cells.
26067234 These results reveal a novel mechanism by which MAF1 and Pol III regulate the activity of the CDKN1A-encoding gene transcribed by Pol II.
26053095 Data show that the protein phosphatase 2A (PP2A)/c-jun N-Terminal Kinase (JNK)/Sp1 transcription factor/CDK1 kinase pathway and the autophagy/cyclin kinase inhibitor p21 pathway participated in G2/M cell cycle arrest triggered by PP2A inhibitors.
26036262 Chromatin immunoprecipitation analysis revealed interaction between SOX9 and the specific region of the p21WAF1/CIP1 promoter. Data suggest that SOX9 is a potential therapeutic target in cervical carcinoma, that transactivates p21WAF1/CIP1
26032092 Together, these data suggest that Curcumin inhibits growth of PC via miR-208-mediated CDKN1A activation
26028110 stratified analysis showed rs1059234 polymorphism was greatly associated with the risk of squamous cell carcinoma of head and neck.
26025442 We conclude that Bz-surviving MM cells display a GRP78(HIGH)/p21(HIGH)/CDK6(LOW)/P-Rb(LOW) profile, and these markers may identify quiescent MM cells capable of fueling recurrences.
26019036 A partially methylated or unmethylated RASSF1A promoter as well as elevated serum AFP level or methylation of p21 in addition to elevated serum AFP level might be associated with poor prognosis in patients with hepatocellular carcinoma.
26012475 miR-20a interferes with the colonic epithelium homeostasis by disrupting the regulation of Myc/p21 by TGF-beta, which is essential for its malignant transformation.
26006237 Loss of p21 in HCT116 Cells Is Associated with Accumulation of DNA Double-Strand Breaks.
26002196 USP1, p21 and Spartan are translesion DNA synthesis regulators. (Review)
25990325 CTDSP2 induces p21(Cip1/Waf1) through increasing the activity of Ras.
25987237 p21(CIP1/WAF1) has a role in decreasing chondrogenic differentiation potential in synovial membrane progenitor cells
25972089 the hydroxyl group of Tyr151 in p21 acts as a tethering point for ideal packing and surface recognition of the peptide interface, increasing the binding affinity of p21 for PCNA.
25959498 Long non-coding RNA GAS5 down-regulation reduced the YBX1 protein level, which decreased YBX1-transactivated p21 expression and abolished G1 phase cell cycle arrest in stomach cancer.
25928067 findings suggest that down-regulation of BANCR contributes to the proliferation of colorectal cancer cells, at least in part, through the regulation of p21 protein.
25925725 p21 may play a key role in apoptosis, proliferation, cell cycle arrest, and antioxidant activity in UVB-irradiated human HaCaT keratinocytes.
25918708 our study identifies a pair of miRNA-dsRNA mediating endogenous p21 overexpression.
25912549 paclitaxel may be an effective anticancer agent through regulating the expression of p21(Cip1) for the treatment of BRAF mutant melanoma cells resistant to BRAF inhibitors.
25896246 Studies on human keratinocytes recognized that loricrin expression was inversely related to the expression of the cyclin-dependent kinase inhibitor p21
25893733 Manipulation of the miR-221/222-Ets-1-p21 pathway may offer a novel strategy for treatment of endothelial apoptosis.
25885043 LIF/p21 signaling cascade as a novel tumor suppressive-like pathway in melanoma, acting downstream of TGFbeta to regulate cell cycle arrest and cell death, further highlight new potential therapeutic strategies for the treatment of cutaneous melanoma
25847297 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
25835715 Mutant p53 expression decreased gradually from cancerous to normal mucosae, whereas p21(CIP1/WAF1) expression displayed an opposite trend
25799222 Single nucleotide polymorphism in CDKN1A gene is associated with colorectal cancer.
25788262 Caffeic acid phenethyl ester induced cell cycle arrest and growth inhibition in prostate cancer cells via regulation of Skp2, p53, p21Cip1, and p27Kip1.
25773855 By down-regulating Bak, P53, P21, BRCA1, BCL-Xl.
25746435 There was a weak linear trend between risk of infection after exposure and increasing p21 gene expression, but again only in one experiment
25733682 The control operated by the cell cycle machinery on MEF2 stability contributes to the downregulation of CDKN1A and entry into S phase in human fibroblasts.
25710583 higher expression in cirrhotic hepatocellular carcinoma Egyptian patients compared with noncirrhotic ones
25699361 Silence of nucleostemin inhibit cell proliferation through up-regulating p21 expression and nucleostemin may be involved in the pathogenesis of esophageal squamous cell carcinoma.
25695884 miR-93 was increased in polycystic ovary syndrome granulosa cells and targeted CDKN1A to promote proliferation and cell cycle progression.
25695279 The study suggest that the Cip/Kip family may have a role as a molecular mechanism of carcinogenesis in early glottic cancer.
25681685 Data suggest that miR-130 plays an role in the repression of CDKN1A by hypoxia. miR-130 enhances hypoxia-induced smooth muscle proliferation.
25675191 Our findings suggest that alteration of p16, p14, p27, p21, and p53 status may contribute to carcinogenesis and the clinical behavior of HPV-negative adenocarcinoma of the uterine cervix
25674264 results suggested that the senescence programs mediated by p15(INK4b), p16(INK4a) and p21(Waf1/Cip1) were activated during the stage of cervical intraepithelial neoplasia and squamous cell carcinoma
25663530 Findings suggest that the regulation of c-Myc in breast cancer cells is dependent on the molecular subtype, and that beta-catenin-mediated regulation of c-Myc and p21 may control the balance of cell death and proliferation in breast cancer.
25635878 These results suggest that INMAP might function through p53/p21 pathways.
25633810 miR-93 stimulated cell proliferation, migration, and invasion through the oncogenic c-Met/PI3K/Akt pathway and also inhibited apoptosis by directly inhibiting PTEN and CDKN1A expression in human hepatocellular carcinoma.
25625488 The cancer-associated variant of p21cip1 may contribute to the loss of cell cycle control in neurons that may lead to Alzheimer-type neurodegeneration.
25616665 A major implication of our studies is that inhibition of miR-520g or restoration of p21 expression may have considerable therapeutic potential to overcome drug resistance in colorectal cancer patients, especially in those with mutant p53.
25578966 phenotype is due to a prolonged G1/S transition via decreasing DICER-dependent biogenesis of miRNA let-7, which increased the p21(Waf1/Cip1)/p27(Kip1) levels
25557355 TLX functions as a potent suppressor of oncogene-induced senescence in prostate cancer via its transcriptional co-regulation of the CDKN1A (p21(WAF1) (/) (CIP1) ) and SIRT1 genes
25547435 HOTAIR served as an onco-lncRNA in cervical cancer which could enhance various aggressive biological behaviors. Moreover, we proved that HOTAIR execute its functions mainly through inhibiting the p21 expression
25544776 Data indicate the role of cyclin-dependent kinase inhibitor 1A (p21) and interleukin enhancer binding factor 3 (ILF3) pathway in mediating the anti-leukemic activity of sodium dichloroacetate (DCA) in oncoprotein p53null leukemic cells.
25532599 Studies performed genotyping analyses of eight functional CDKN1A p21, oncoprotein p53, TP53BP1 protein and tumor protein p73 single nucleotide polymorphisms (SNPs) in 330 gastric cardia adenocarcinoma (GCA) cases and 608 controls in a Chinese population.
25524938 Although its expression increases in patients with N1 regional metastasis, the loss of p21{WAF1/CIP1} does not seem to have any relationship with the clinical and pathological variables of the tumors.
25521075 In a mouse tumor xenograft model Lack of p21 protein increased sensitivity to the apoptotic effects of the combination of tetrandrine and chloroquine.
25510663 Through its interference with the LKB1-p53-p21/WAF1 pathway expression.
25504755 Results show that lncRNA ANRIL plays a key role in non-small cell lung cancer (NSCLC) development by associating its expression with survival in patients with NSCLC through silencing of KLF2 and P21 transcription.
25486478 These findings support a model in which in human cells a balance between ATM-Chk2-p53 and the ATR-Chk1 pathways modulates p21(Waf1) protein levels in relation to cytostatic and cytotoxic doses of DNA damage.
25483783 Data suggest an association of ANKHD1 (Ankyrin repeat and KH domain-containing protein 1) protein with p21 (WAF1/CIP1) promoter region.
25483104 Deficiency of p21 renders tumor cells more susceptible to Polo-like kinase 1 inhibition by showing a pronounced mitotic arrest, DNA damage and apoptosis.
25474241 Results revealed a novel interplay between IKKepsilon, CHEK1 and p21 signaling in survival of ovarian cancer cells.
25460500 the non-calcemic 1,25(OH)2D3 analogue (EB1089), induces BRCA1 association with the vitamin D receptor...to enhance CDKN1A expression
25450384 KDM5B promoted glioma proliferation partly via regulation of the expression of p21.
25447520 up-regulation of p21(WAF1/CIP1) by miRNAs in bladder cancer cells
25435372 Analysis of breast cancer samples reveals that a high LRH-1 level is inversely correlated with CDKN1A expression in breast cancer patients and is associated with poor prognosis
25421815 The increase in p21 expression in RPE cells not only inhibits the proliferation and migration of RPE cells in vitro, but also suppresses the development of proliferative vitreoretinopathy in vivo.
25412309 PKCeta promotes senescence through its ability to upregulate the expression of the cell cycle inhibitors p21Cip1 and p27Kip1 and enhance transcription and secretion of IL-6.
25394506 Knockdown of endogenous Msi1 protein inhibited the growth and tumor formation by activating the cell cycle suppressor p21cip
25384499 Chidamide treatment significantly decreased the expression of p21 and increased the ratio of Bax/Bcl-2 expression.
25371069 Downregulated p21 expression.
25361006 Underexpression of Cip1 is associated with melanoma.
25349305 Results propose that combined TP53/CDKN1A mutation with loss of function of both proteins defines a molecular subset of bladder cancer with particular sensitivity to the combination of a DNA-damaging chemotherapy as gemcitabine and a Chk1 inhibitor.
25333671 Cigarette smoking and overexpression of p53 or p21 are associated with poor prognosis in non-small cell lung cancer.
25329316 LKB1 mediates CDKN1A degradation in response to ultraviolet DNA damage.
25304329 The time-course of decreasing ROS coincides with an increase in cell number and decreasing p21 protein levels, indicating a release from radiation-induced growth arrest.
25295585 There is an ER stress-dependent p53 pathway that suppresses p21 and lowers the apoptotic threshold to genotoxic drugs. This prevents p21 from promoting COP1-mediated 14-3-3sigma degradation and leads to G2 arrest.
25288747 KAISO is a regulator of p53-mediated transcription of CDKN1A and apoptotic genes
25281925 FOXA1/2 is required for p53-independent p21 expression
25275486 Epstein-Barr virus nuclear antigen 3A promotes cellular proliferation by repression of the cyclin-dependent kinase inhibitor p21WAF1/CIP1
25267623 Two states--quiescence and cell cycling--can coexist within an isogenic population of human cells and resulted from low basal expression levels of p21.
25267570 The CDKN1A (rs1801270) mutant genotype was associated with decreased risk of hematologic toxicity in gastric cancer patients.
25263704 osteoclastogenic activity of translationally-controlled tumor protein (TCTP) with reciprocal repression of p21
25236744 OXR1 upregulates the expression of antioxidant genes via the p21 signaling pathway to suppress hydrogen peroxide-induced oxidative stress and maintain mtDNA integrity.
25227106 The proliferation inhibition and apoptosis of EC9706 cells mediated by SIRT3 downregulation may be closely associated with the expression levels of p21, Bcl-2 and Bax proteins.
25203321 FAL1 associates with the epigenetic repressor BMI1 and regulates its stability in order to modulate the transcription of a number of genes including CDKN1A.
25155625 SAHA/bortezomib up-regulated the expression of CDKN2A and CDKN1A but did not affect the level of BCL2L11 or BHRF1 (viral homologue of BCL2).
25151143 no association between rs1059234 polymorphism of p21 gene and risk of endometrial cancer
25141863 Functional studies reveal that p21 and p53 cooperate to facilitate Mdm2-dependent Slug degradation and that this p53 function is mimicked by p53(R273H), a mutant lacking trans-activating activity.
25131797 conclude that p21/cyclin E pathway is crucial in modulating the anticlastogenic function of Bmi-1
25121590 Our study demonstrated that EBNA3C significantly induces Pim-1 mediated proteosomal degradation of p21
25120812 In conclusion, p53, p21 and Cdc2 may be involved in the occurrence, development and recurrence of laryngeal squamous cell carcinoma.
25088197 Data have identified a novel TWIST2-p21 axis that regulates the cell cycle of both normal and leukemic hematopoietic cells, which implicates TWIST2 as a novel tumor suppressor in human acute myeloid leukemia.
25058453 An increase of cytoplasmic nuclear p21 and activated caspase-3 expression.
25051367 HMGB1 deficiency-induced inhibition of cell proliferation was mediated by p21, which was induced via a Sp1-dependent mechanism. Data demonstrate a novel oncogenic role of HMGB1 in promoting human melanoma cell proliferation.
25024194 results establish that inactivation of p21 leads to increased apoptosis upon telomerase inhibition and thus identify a genetic vulnerability that can be exploited to treat many human cancers containing either wild-type or mutant p53.
24993775 Data showed that BRG1 as target protein of UCA1 with anti-oncogenic features in bladder cancer cells. UCA1 blocked recruitment of BRG1 to its target promoter, and thus led to reduced expression of p21 and accelerated cell growth.
24989082 miR-17 promotes the tumor growth of synovial sarcomas by post-transcriptional suppression of p21.
24983498 SET/TAF-Ibeta inhibits FoxO1 acetylation and activates its transcriptional activity toward p21
24978920 p53, KLF4, and p21 showed altered expression patterns in pulmonary neuroendocrine neoplasms. Lack of KLF4 and p21 expression was associated with accumulation of aggressive features in typical carcinoids.
24975575 the results suggest Cables1 as a novel p21 regulator through maintaining p21 stability and support the model that the tumor-suppressive function of Cables1 occurs at least in part through enhancing the tumor-suppressive activity of p21.
24943991 Expression of p21 gene decreased in endometrial cancer.
24921914 Findings shed novel light on the roles of miR-224/p21(WAF1/CIP1) signalling in the DDP resistance of LA cells, and targeting it will be a potential strategic approach for reversing the DDP resistance in human LAs.
24896240 We demonstrated that HDAC4 promotes gastric cancer cell progression mediated through the repression of p21.
24858206 Low Cip1 expression is associated with ovarian cancer.
24848107 p57 and p21 serve nonredundant functions in trophoblast giant cells; the role of p21 in suppressing apoptosis is restricted to terminally differentiated cells.
24824184 Our findings highlight a PFTK1-CCNY complex in activating noncanonical Wnt signaling in HCC cells.
24821728 PLZF-RARalpha as an oncogenic transcriptional repressor of cyclin-dependent kinase inhibitor 1A (p21WAF/CDKN1A) and tumor protein p53 (TP53) genes
24821727 PLZF can directly repress transcription of CDKN1A encoding p21
24820515 p21 rs3176352 G>C and p73 rs1801173 C>T SNPs are associated with increased risk of esophageal squamous cell carcinoma
24801890 Notch1-mediated repression of p21(waf1/Cip1) expression results in the inhibition of cell death and keratinocytes transformation.
24798519 P53 and p21 null cells escaped complete arrest.
24782314 provide evidence that p21 is activated in aneuploid cells by reactive oxygen species (ROS) and p38 MAPK
24777035 Whole-genome sequencing of bladder cancers reveals somatic CDKN1A mutations and clinicopathological associations with mutation burden.
24774361 Atherosclerotic plaque smooth muscle cell proliferation is reduced via a p21-dependent mechanism.
24760188 Suppression of p21Rac activity assists innate immunity in bactericidal activity and may induce remission in inflammatory bowel disease.
24748121 APTR associates with the promoter of CDKN1A/p21 and this association requires a complementary-Alu sequence encoded in APTR. A different module of APTR associates with and recruits the Polycomb repressive complex 2 (PRC2) to repress the p21 promote
24747435 this study highlights a novel SATB1-p21 axis that plays an important role in the disease progression of cutaneous CD30+LPDs, which provides novel molecular insights into this disease and possibly leads to new therapies in the future.
24745156 The assessment of p53 and p21 can be expensive, but it proves to be a useful tool in difficult cases
24744753 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
24740926 we provide genetic and biochemical evidence that the JMJD5/CDKN1A (p21) axis is essential to maintaining the short G1 phase which is critical for pluripotency in human embryonic stem cells
24731397 Following upregulation, PRP19 repressed cell proliferation and tumor growth by upregulating the expression of the cell cycle arrest protein p21 in lung carcinoma tissues.
24708484 These show high p21 and CD166 expression at the pretreatment biopsy were associated with tumor regression and poor prognosis in patients treated with 5-FU based chemoradiotherapy
24706169 We show for the first time the presence of HER2/HER3 heterodimers and the loss of p21 expression in HER2+ breast cancer predicts a significantly poorer outcome when submitted to adjuvant trastuzumab
24705889 bone marrow mesenchymal stromal cells affect the cell cycle arrest effect of genotoxic agents on acute lymphocytic leukemia cells via p21 down-regulation.
24699724 while interaction with PCNA was important for targeting p21 to the CRL4Cdt2 ligase re-localized to MVM replication centers
24691284 Our findings suggest that the 3'UTR P21 polymorphism may play an important role in the pathogenesis and initiation, but not in the progression, of undifferentiated nasopharyngeal carcinoma
24658320 The loss of expression of Stat1 and p21 proteins corresponded to lymph node metastasis, advanced stage, tumor dedifferentiation, and poor prognosis in patients with pancreatic cancer.
24645745 the meta-analysis suggested that, in the p21 Ser31Arg polymorphism, Ser-allele and Ser/Ser genotype might be risk factors for gastrointestinal tract tumor in Asian populations
24628257 Knockdown of NS inhibited proliferation, arrested the cell cycle, and induced apoptosis through p53 and p21(Waf1/Cip1) pathways in MOLT-4 cells.
24626178 CDKN1A variant rs762623 is associated with the development but not the propagation of progressive liver disease in non-alcohol-related fatty liver disease.
24619835 High CIP1 expression is associated with vascular invasion in gastric cancer.
24599959 PKCdelta activates a MEKK1/MEK3/p38delta MAPK cascade to increase p53 levels and p53 drives p21(Cip1) gene expression.
24594805 results suggest that activation of the p21 upstream promoter is mediated by interaction between specific regions of TLP and p53
24589735 Impact of Dux4 on p53/p21 signal pathway, which controls the checkpoint in cell cycle progression. Overexpression of Dux4 increased p21 mRNA and protein level, while expression of p53, phospho-p53 remained unchanged.
24588771 Data suggest that EZH2 depletion promotes the progression of senescence by mediating the activation of tumor suppressor genes p21 and p16.
24568186 upregulation of p53 and p21 via HO-1 induction and subsequent release of iron with accumulation of H-ferritin may confer resistance to oxidative damage in cancer cells frequently challenged by redox-cycling anticancer drugs.
24526736 hTOP3alpha interacts with p53, regulates p53 and p21 expression, and contributes to the p53-mediated tumor suppression
24492005 G9a functions as a coactivator for p21 transcription, and directs cells to undergo apoptosis.
24469921 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
24467951 Resveratrol caused apoptosis in cigarette smoke-induced cancer cells by reduction of long patch base excision repair activity and this phenomenon largely depends on p21.
24464128 the significant association of p21 mutation and hypermethylation leads to the complete inactivation of p21 gene in Indian female breast cancer patients.
24445528 p21 transcription during replicative senescence of HEFs is up-regulated by increase in DNA binding activity and interaction between p53 and Sp1 via phosphorylation.
24424505 TDE2 may have an effect on tumor cell growth by influencing the expression of SREBP and p21.
24407240 Association of p21 with NF-YA suppresses the expression of PLK1 and prevents mitotic death in response to DNA damage.
24387689 Existence of a tri-allelic polymorphism in the promoter of p21(Waf1/Cip1). It has also shown the heterozygous genotype 9T/11T to be a potential risk factor for gastric cancer in the Chinese population.[meta-analysis]
24384472 A pivotal role of arginine 213 determines the p53 mediated functions of p21 in human cancer cells.
24384380 Shikonin induces cell cycle arrest in human gastric cancer by Egr1-mediated p21 gene expression.
24379070 The p53-CDKN1A-Bax signaling pathway appears to be activated in recurrenct spontaneous abortion.
24365999 The same result was achieved by knocking down p53 and p21 with siRNA in p53-wt cells, indicating that p53 and p21 play a crucial role in MHY336-induced cell cycle arrest and apoptosis
24356969 Rbm24 is a novel player in the p53 pathway, which may be explored to restore proper cell cycle control in p53-deficient tumors via p21.
24322019 Immunofluorescence expression (IFE) of cell cycle regulators p16ink4a, p21, p27, in association with Ki-67, p53 in cell cultures, obtained from different types of cervical intra-epithelial lesions, was assessed.
24317508 these data demonstrate that p21 is important for a fine-tuned control of the Cdk1 activity in mitosis, and its proper function facilitates a smooth mitotic progression.
24291038 Airborne particulate matter exposure induced cytoplasmic p21(CIP1/WAF1) retention, ERK1/2 activation, cytoskeleton remodeling and the acquisition of a senescence-like phenotype in lung cells.
24283290 Data suggest that ESR1 (estrogen receptor 1) regulates cell cycle by suppressing expression of p53/p21 (tumor protein p53/cyclin-dependent kinase inhibitor 1A protein) and up-regulating proliferating cell nuclear antigen (PCNA).
24277930 Data indicate that p21 forms a complex with ZEB1 at the miR-183-96-182 cluster promoter to inhibit transcriptional repression of this cluster by ZEB1, suggesting a reciprocal feedback loop.
24277474 Data suggest that assessing expression of thymidylate synthase and in conjunction with p21(WAF1)/p53 of colon cancers may improve the selection of patients suitable for 5-fluorouracil (5FU)-based adjuvant chemotherapy.
24244542 Our findings thus indicate that TSG101 regulation of p21 is an important factor in the cellular function of TSG101.
24225749 Our results suggest p21 expression may serve as a new biomarker to predict clinical outcome in patients with myelodysplastic syndrome
24217248 Intestinal cell proliferation and senescence are regulated by receptor guanylyl cyclase C and p21.
24196441 our data demonstrate that CtIP is required for DNA damage-induced P21 induction.
24162774 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
24155936 upregulation of HOTAIR contributes to the cisplatin resistance of lung adenocarcinoma cells, at least in part, through the regulation of p21 expression.
24151513 p53/p21 Pathway involved in mediating cellular senescence of bone marrow-derived mesenchymal stem cells from systemic lupus erythematosus patients.
24134839 p21 gene promoter contains numerous p53 target sequences, some of which have inverted repeats capable of forming cruciform structures.
24130040 Wnt/beta-catenin signaling mediates the senescence of bone marrow-mesenchymal stem cells from systemic lupus erythematosus patients through the p53/p21 pathway.
24127074 Nuclear and cytoplasmic p21 protein levels were significantly reduced and increased in gastric cancer lesions, respectively. Low nuclear p21 or high cytoplasmic p21 correlated with shorter overall survival and clinicopathologic characteristics.
24123000 P21 expression correlates with the 5 year survival rate in esophageal squamous cell carcinoma patients.
24119401 Dosage of Dyrk1a repositions cells within a p21-CycD1 signaling map, directing each cell to either proliferate or to follow two distinct cell cycle exit pathways characterized by high or low CycD1 and p21 levels.
24113348 These observations suggest that RAGE promotes premature senescence of proximal tubular epithelial cells by activation of endoplasmic reticulum stress-dependent p21 signaling.
24096545 The genes c-Myc, p21, and p16 were correlated with the prognosis of triple-negative breast cancer
24096481 E2F4 complexes are effectors of p21-dependent p53-mediated repression.
24092862 p21 is required for sustained liver regeneration and tumour development in chronic liver injury. p21 is a negative prognostic marker in human hepatocellular carcinoma.
24082141 p21-mediated RNR2 repression restricts HIV-1 replication in macrophages by inhibiting dNTP biosynthesis pathway.
24076166 Cigarette smoke extracts (CSE) increased the expression of p21 in CSE stimulated bronchial epithelial cells and carbocysteine was able to reduce this effect.
24074410 Downregulation of mutant p53 with concomitant enhanced expression of p21(waf1/cip1) and its transcriptional trans-activators may contribute toward EZH2-mediated suppression of pancreatic ductal adenocarcinoma.
24052415 These observations suggest an intrinsic cooperation between p21 and p27 CKIs in the activation of stress-induced cellular senescence and tumor progression in glandular proliferative lesions
24045412 The minor alleles of polymorphisms in CDKN1A (p21) gene may act as risk factors for the development of RB.
24027428 Knockdown of p21 partially rescues the cell growth arrest induced by the BCA2 siRNA.
24008375 Treatment with metformin upregulated the expression of p21CIP and p27KIP, but downregulated cyclin D1 levels, both in vitro and in vivo
24005533 A significant 2.21-fold increase in the chance of developing breast cancer was observed in the candidates carrying at least one allele Arg mutant in p21/CIP1 genotype.
23982416 Cyclin-dependent kinase inhibitors, p21 and p27, are upregulated by PXD101 in a sustained fashion in histone deacetylase inhibitor resistant cell lines.
23949224 Senescence caused by AP4-deficiency was prevented by depletion of p16 and/or p21, demonstrating that these factors mediate senescence caused by AP4 loss.
23928864 Ex vivo expansion protocols involving hypoxic preconditioning inhibit cell senescence in endothelial progenitor cells by hypoxia-induced hypoxia-inducible factor-1alpha-TWIST-p21 axis.
23921628 Our data suggest the possibility of epigenetic modification of Prostate-derived Ets factor due to DNA methylation and involvement of the cell cycle inhibitor p21.
23894605 The present report shows that p16 positively regulates the basal expression of p21 in various human cell types and mouse embryonic fibroblasts.
23886938 Phosphorylation by Lats2 induces degradation of p21 and promotes apoptosis. Lats2 overexpression induces p21 degradation, activation of caspase-3 and caspase-9, and apoptosis.
23856463 CD44 increases phorbol ester-induced expression of p21WAF1 by stabilizing its mRNA and extending protein half-life
23839046 FMN2 is a crucial protein involved in the control of p21.
23832542 Studies indicate there is no association between p21 Ser31Arg polymorphism and cervical cancer risk in Asians.
23832541 Data indicate there was no statistical significance observed between the immunoexpression of p16, p21, p27, and pRb with nodal metastasis, depth of invasion, and presence of vascular or perineural invasion.
23813879 ATR stabilizes the CDKN1A message in response to UV damage through Cdk1-related cytoplasmic accumulation of HuR.
23807750 Data indicate that p27 expression and microvessel density (MVD) dramatically decreased during the transition from in situ to invasive ductal carcinomas (IDC), and a low c-kit expression was indicative of IDC relapse.
23786849 Thus, our findings highlight the cyclin D1/p21 signaling axis as a critical regulator of TGFb-mediated tumor growth initiation and local tumor cell invasion, both in vitro and in vivo.
23780339 miR-17-5p is induced in irradiated OC3 cells and it downregulates p21 protein expression, contributing to the radioresistance of OC3 cells.
23759594 An unexpected role of p38 in cell cycle regulation in response to Aurora B inhibition, by promoting the transcriptional elongation of the cell cycle inhibitor p21.
23754829 Immunostaining of p16(INK4a) and p21(WAF1/Cip1) provides additional information on the cytological diagnosis of squamous intraepithelial lesions of the uterine cervix.
23745637 Data suggest that CDKN1A stability in keratinocytes is regulated (up-regulation; down-regulation) by mechanisms involving S100A11 (S100 calcium binding protein A11) and ubiquitin-independent proteasomal degradation.
23737759 CDK7 involved in phosphorylation/activation of CDK4 and CDK6; existence of CDK4-activating kinase(s) other than CDK7; and novel CDK7-dependent positive feedbacks mediated by p21 phosphorylation by CDK4 and CDK2 to sustain CDK4 activation.
23715767 Transcription of the p21Waf1/Cip1 and JNK-1 genes is affected by inhibition of the early growth response-1(Egr-1).
23715670 in 85 sporadic parathyroid adenomas, study identified alterations in 5 adenomas: 2 contained heterozygous changes in CDKN1A, 1 germline and 1 of undetermined germline status; 1 had a CDKN2B germline alteration, accompanied by loss of the normal allele in the tumor (LOH); 2 had variants of CDKN2C, 1 somatic and 1 germline with LOH
23684928 Report prostate cancer G0/G1 cell cycle arrest via cdk4/p21 pathway.
23665236 EVI1 binds to DeltaNp63 promoter element directly and down regulates its expression, inducing the expression of p21 in colon carcinoma cells that do not express p53, that eventually delay cell cycle progression at G0/G1 phase.
23652278 OSU-03012 induces apoptosis in human esophageal carcinoma cells through a p53/Bax/cytochrome c/caspase-9-dependent pathway.
23639631 In large airway epithelium of smokers with and without COPD, the cytoplasmic p21 inhibits cell apoptosis, promotes cell proliferation and correlates with squamous cell metaplasia thus representing a potential pre-oncogenic hallmark
23618860 Surprisingly, we found that GRP/GRP-R differentially induced expressions of p21 and p27. Silencing GRP/GRP-R decreased p21, but it increased p27 expressions in neuroblastoma cells.
23603558 EZH2 has a role in regulation of p21 and mutant p53 involved in growth of ovarian cancer
23601845 miR-223 functions as a tumor suppresser in osteosarcoma and miR-223/Ect2/p21 signaling is an important pathway that regulates the osteosarcoma cell cycle progression and proliferaion
23590292 Suggest that HBx induces hepatocarcinogenesis via PKCalpha-mediated overexpression of cytoplasmic p21 and IFN-beta suppressed these molecular events by shifting p21 to the nucleus.
23582783 The results indicated that miR-22 directly targets CDKN1A, and the expression of miR-22 was inversely correlated with CDKN1A expression in hepatitis B virus-related hepatocellular carcinoma
23577194 HCV core protein suppresses p21(Waf1/Cip1) gene expression through miR-345 targeting.
23555284 FXR1P muscle-specific isoforms bind p21 mRNA via direct interaction with a conserved G-quadruplex located in its 3' untranslated region. The FXR1P/G-quadruplex complex reduces the half-life of p21 mRNA.
23542179 Enhanced the association of PPARgamma with the p21(WAF1/Cip1) promoter.
23536437 Data indicate that exposure to benzylguanine (6BG)/temozolomide (TMZ) led to increases in p53, p21, gamma-H2AX, and mitochondrial DNA damage.
23458879 Based on our observation of G1/G0 cell cycle arrest in Batten cells, we monitored p21 expression, which was higher in Batten disease cells than in normal cells.
23457546 human myeloid cell line constitutively overexpressing EVI1 was partially resistant to etoposide and daunorubicin
23449391 p53 promotes VEGF expression and angiogenesis in the absence of an intact p21-Rb pathway.
23399735 MiR-224 is overexpressed in inflammatory bowel disease cancers and targets p21, a key cell cycle regulator.
23388456 HSF1/SESN3/reactive oxygen species/p21(Cip1/WAF1)-mediated deceleration of cell growth may contribute to cell defense systems protecting the organism from excessive proliferation of cells that overexpress activated Ras oncoproteins.
23382584 TP53, P21 and P27 positivity correlates with survival outcome in low-stage epithelial ovarian cancer.
23376845 The data collectively suggest that triiodothyronine and its receptor signaling suppresses cell proliferation by upregulating endoglin, in turn, affecting p21 stability.
23375502 FMN2 enhances expression of the cell-cycle inhibitor p21 by preventing its degradation
23359201 Our data suggest that inactivation of p53 and p21 may play an important role in the evolution of carcinoma ex pleomorphic adenoma
23349842 Results demonstrate that both TRB3 and p21(Cip1) are critical molecules in the homocysteine signaling cascade.
23349794 Data show that histone deacetylase inhibitors (HDACi) induce p21 transcription and reduce cell proliferation of MDA-MB231, an ERalpha-negative mammary tumor cell line, in a H2A.Z dependent manner.
23333304 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
23333058 Fndings indicate that miR-17-5p/20a promote gastric cancer cell proliferation and inhibit cell apoptosis via post-transcriptional modulation of p21 and TP53INP1.
23329847 Data indicate BOZF1 represses transcription of CDKN1A by inhibition of p53 acetylation and Sp1 binding.
23324739 Up-regulation of p21 protein is expected to play a significant role in congenital cholesteatoma
23318451 Data indicate TRIM3 and p21 interact in cells.
23306186 one of the two single nucleotide polymorphisms of CDKN1A seems in some way related to Alzheimer's disease
23306062 Data show that E2F1 overexpression, due to p53 or p21 inactivation, promotes expression of human oncoprotein CIP2A.
23292332 The p21 C70T polymorphism is associated with decreased risk of prostate cancer in Slovak men.
23275116 The negative expression of p21 correlates with disease survival and may be a poor prognostic factor in patients with resected gastric cancer treated with adjuvant chemotherapy.
23271730 Interleukin-20 promotes migration of bladder cancer cells through extracellular signal-regulated kinase (ERK)-mediated MMP-9 protein expression leading to nuclear factor (NF-kappaB) activation by inducing the up-regulation of p21(WAF1) protein expression
23261678 Oleuropein down-regulates NF-kappa B and cyclin D1 but activates p21 in MCF-7.
23255119 The p21 overexpression leads to a dual outcome, activating the G/S arrest of the cell cycle or the apoptotic pathway through mitochondria, depending on its intracellular levels.
23253087 Two separate defects in p53 signaling appeared common: in nevi, lack of p53 phosphorylation by activated CHEK2, and in melanomas, defective p21 upregulation by p53 even when phosphorylated.
23238566 The p21 acetylation at sites 161 and 163 is required for stabilization of functional p21 after DNA-damaging stress.
23236067 during cytomegalovirus infection, pUL29/28 and pUL38 contributed to inhibition of p21CIP1 and caspase 1 expression; expression of pUL29/28 and pUL38 contributed to an increase in steady-state levels of p53; study identified 2 additional HCMV proteins, pUL29/28 and pUL38, which participate in regulation of p53 transcription activity
23231583 The three p21 SNPs (rs1801270, rs3176352, and rs1059234) was in linkage disequilibrium.
23224600 Waf1 is expressed during the follicular phase in the submucosal layer of the myometrium.
23219618 CD34(+) cells from patients with lower-risk myelodysplastic syndrome present p21 dependent premature senescence.
23215027 The p21(WAF1/CIP1) gene may have been methylated and hence is inactive in MCF-7/ADR cells.
23213251 TRIM39 has a role in regulating cell cycle progression and the balance between cytostasis and apoptosis after DNA damage via stabilizing p21
23211592 these results suggest that the loss of p21 results in an aberrant increase in the mitochondrial mass and in mitochondrial dysfunction in HCT116 cells, indicating that p21 is required to maintain proper mitochondrial mass and respiratory function.
23210340 p21(C31A)polymorphism contributes to the risk of primary open-angle glaucoma onset in Russian and Buryat populations
23208500 Consistent with p53 derepression, NF90/NF45-depleted HeLa cells displayed elevated poly ADP-ribose polymerase (PARP) cleavage and susceptibility to camptothecin-induced apoptosis.
23187802 p53 can repress transcription of cell cycle genes through a p21(WAF1/CIP1)-dependent switch from MMB to DREAM protein complex binding at CHR promoter elements.
23184467 Data indicate that the signal transducer and activator of transcription 6 (Stat6) as an important cell differentiation regulatory protein functioning by interacting with Sp1 to activate the p21 and p27 gene promoters in breast cancer cells.
23178572 HIC1 is a direct transcriptional repressor of p21.
23167427 our results strongly suggest that p21CIP1 acts as an effector of cytoplasmic gelsolin and plays an important role in gelsolin-induced monocytic differentiation of U937 cells.
23167335 In the present study, the p21 codon ser31arg polymorphism was significantly associated with increased risk for acute myeloid leukemia.
23160381 Galectin-3 regulates p21 protein stability in human prostate cancer cells.
23159636 Androgen receptor down-regulates basal p21 expression through the PIRH2-p53-p21 axis in androgen- independent prostate cancer cells, thereby priming the cells to UV-induced apoptosis.
23158659 The expressions of p21(Cip1/WAF1), Gadd45alpha and p53 are associated with the clinicopathologic features and prognosis in breast cancer.
23153928 Murine double minute 2 (MDM2) protein levels were decreased in AD cells relative to control lymphoblasts, suggesting an impairment of FOXO3a degradation.
23146670 age-dependent p400 downregulation and loss of H2A.Z localisation may contribute to the onset of replicative senescence through a sustained high rate of p21 transcription
23133524 Gatifloxacin induces S and G2-phase cell cycle arrest in pancreatic cancer cells via p21/p27/p53
23128396 findings substantiate PIR2/Rnf144b as a potentially critical component of epithelial homeostasis, acting downstream of DeltaNp63alpha to regulate cellular levels of p21(WAF1/CIP1) and DeltaNp63alpha
23085987 The data indicated a novel role for Wig1 in RNA-induced silencing complex target accessibility, which is a key step in RNA-mediated gene silencing. Fine tuning of p21 levels by Wig1 was essential for the prevention of cellular senescence.
23085750 GSK3beta phosphorylation of the KLF6 tumor suppressor promotes its transactivation of p21.
23066038 Search of the ENCODE database identified the Sp1/Sp3 palindrome element as the only vertebrate-conserved element within the 500-bp proximal p21 promoter region, indicating its fundamental importance.
23037503 Low doses of parthenolide inhibit tumor promotion and epigenetically modulate p21 expression, highlighting the potential role of this drug as a chemopreventive agent and in epigenetic cancer therapy.
23034899 Cip1 polymorphisms are associated with hepatocellular cancer.
23013131 Exposure of cells to aldosterone for 3 or 5 days increased senescence-associated beta-galactosidase staining, p21 and TNF-alpha mRNA expression.
23007395 Tyrosine phosphorylation of the p21 cyclin-dependent kinase inhibitor facilitates the development of proneural glioma
23007394 the HIC-5- and KLF4-dependent mechanism transactivates p21(Cip1) in response to anchorage loss
22997714 [review] Small molecules like p21 and PUMA may play a role in the pathogenesis of rheumatoid arthritis.
22995475 these results highlight an important role for p21 and p/CAF in promoting breast cancer cell migration and invasion at the transcriptional level and may open new avenues for breast cancer therapy.
22995373 Immunohistochemical determination of p21 may be helpful for the typing of ovarian tumors as benign, borderline and malignant or serous and mucinous.
22988851 A structural adaptation mechanism involving a stretchable dynamic linker helix allows p21 to promiscuously recognize the various Cdk (cyclin-dependent kinase)-cyclin complexes that regulate cell division.
22980580 Co-culture of CB CD34(+) cells with mesenchymal stromal cells, especially in the absence of cytokines, maintained mRNA expression of p21 and p57 genes in ex vivo expanded CD34(+) cells.
22964432 Results highlight the potential roles of ERalpha and p21(WAF1) in growth inhibition of cancer cells mediated by proteasome inhibitors, such as bortezomib.
22956625 data suggest that EZH2 is overexpressed in B-ALL and promotes the progression of B-ALL by directly mediating the inactivation of tumor suppressor genes p21 and PTEN
22869584 Data indicate LNP-dsP21-322-2'F facilitates tumor suppressor p21(WAF1/CIP1) activation in vivo leading to regression/disappearance of tumors.
22859066 Low concentration of dihydrotestosterone induced lower mRNA levels in the p53 and p21 genes in non-transformed epithelial prostatic cells. High dihydrotestosterone concentrations induced a significant increase in the expression of the p53 and p21 genes.
22858377 findings elucidate a NUPR1-PI-3-K/Akt-phospho-p21 axis that functions in p53-negative, inflammatory breast cancer cells to enhance chemoresistance
22828875 P12(CDK2-AP1) was found to be significantly downregulated in 60 breast cancer tissues compared to corresponding non-tumorous tissues.
22820403 Together, these results suggest that the p53-p21 pathway is required for efficient herpes simplex virus type 2 lytic replication cycle.
22814742 Cyclin D1 was down-regulated, while p21 expression was up-regulated by EGCG in dose- and time-dependent manners.
22814028 the overexpression of p21 Waf1/Cip1 was involved in inhibition of proliferation and DNA synthesis in colon adenocarcinoma HT-29 cells
22797886 results indicate that the angiostatic action of IL-12-stimulated lymphomononuclear cells may lie in the capability to arrest endothelial cells in G1 phase through a mechanisms mainly based on the specific up-regulation of p21(Cip1/Waf1)
22771799 These findings provide biological insights into the possible role of nonsense-mediated mRNA decay in diverse biological pathways mediated by CDKN1A.
22751124 p21CIP1 regulates metastasis by mediating reciprocal switching between invasion and proliferation
22735451 Trim71 cooperates with microRNAs to repress Cdkn1a expression and promote embryonic stem cell proliferation
22732402 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
22713239 The activation of p21 transcription required an intact PCAF HAT domain.
22711822 Binding of ZONAB to mRNA is activated by GEF-H1 via Rho stimulation and also mediates Ras-induced p21 expression.
22698403 Data show that regulation of p21 by ID1 and ID3 is a central mechanism preventing the accumulation of excess DNA damage and subsequent functional exhaustion of cancer-initiating cells (C-ICs).
22684370 results suggest downregulation of p21waf1/cip1, which is a characteristic feature of NALM-6/SP-B cells, was important for their resistance to spiruchostatin B (SP-B)and this SP-B resistance could be overcome by the introduction of exogenous p21waf1/cip1
22683204 In response to replicative stress and unresolved DNA damage, p53 is hyperactivated in FA cells and triggers a late p21(Cdkn1a)-dependent G0/G1 cell-cycle arrest.
22675167 Findings implicate blockade of the ATM-p53-p21 pathway at the level of p21 as a unrecognized determinant of early disease recurrence following successful cytoreduction.
22673765 The activation of p21(Waf1/Cip1) was significantly up-regulated over time, but there was no change in the level of CDK2 expression by treatment of HEK293 cells with various concentrations of veterinary antibiotics.
22662213 p21 activity as inhibitor of cell cycle progression would be mediated not only by the inhibition of CDKs but also by the transcriptional down-regulation of key genes.
22650359 Study suggests overexpression of BMPRIB may arrest and induce the differentiation of glioblastoma cells due to upregulation of p21 and p27kip1 and that decreased expression of BMPRIB in glioblastoma cells contributes to glioma tumorigenicity.
22634755 We identified three new CRC risk loci at 6p21 (rs1321311, near CDKN1A; P = 1.14 x 10(-10)), 11q13.4 (rs3824999, intronic to POLD3; P = 3.65 x 10(-10)) and Xp22.2 (rs5934683, near SHROOM2; P = 7.30 x 10(-10)).
22615960 we present here data suggesting that p21 and hif1alpha mRNA plasma expressions may be used as markers for complicated pregnancies
22555846 Positively stained p53, p21, and prelamin A proteins are upregulated in senescent aortic smooth muscle cells of a nephrectomixed rat model.
22547681 miR-519 promotes DNA damage, alters Ca(2+) homeostasis, and enhances energy production; together, these processes elevate the expression level of p21, promoting growth inhibition and cell survival.
22547059 Ccr4d functions as an anti-proliferating protein through the induction of cell cycle arrest via a p21-dependent and p53-independent pathway and suggest that Ccr4d might have an important role in carcinogenesis.
22521293 ETS1, ERK2 andMxi2 are important complex partners initiating increased p16INK4a and p21waf1/cip1 activation in renal tumor cells
22514271 These results thus implicate the E2A-CDKN1A transcriptional axis in the control of megakaryopoiesis and reveal the lineage-selective inhibition of this axis as a likely mechanistic basis for the inhibitory effects of cAMP signaling.
22511763 TLP mediates p53-governed transcriptional activation of the p21 upstream promoter.
22511267 Data show that the hESC-enriched miRNA family miR-302 (miR-302a, miR-302b, miR-302c, and miR-302d) directly contributes to regulation of p21 expression in hESCs and, thus, demonstrate a novel function for miR-302s in hESCS.
22510560 Attenuated p21 expression may render some p53 wild type tumors sensitive to a combination of DNA damage plus checkpoint inhibition.
22503977 survivin may act as a transcription factor or cofactor to interact with p53 on the p21(WAF1/CIP1) promoter leading to the inhibition of p21(WAF1/CIP1) expression at least in part by neutralizing p53-mediated transcriptional activation of the p21 gene.
22490020 the role of TAK1 in cell death, cell cycle regulation and apoptosis after X irradiation is independent of NF-kappaB, p38 MAPK, and ERK phosphorylation, and dependent, in part, on p21 induction
22469187 Data indicate that in arecoline treated oral squamous cell carcinoma cells, elevated levels of p21 and p27 could be downregulated through the reactive oxygen species/mTOR complex 1 (ROS/mTORC1) pathway.
22449259 The results suggest that p27 T109G polymorphism individually or in combination with p21 (C98A and C70T) polymorphisms increases risk of SPM in patients with index SCCHN.
22446964 Genetic polymorphisms in CDKN1A gene is associated with autoimmune disease.
22428663 This report describes how carboxylated multiwalled carbon nanotubes (MWCNTs) induce p53-independent p21 expression and cell cycle arrest.
22427654 SFN increases p21(Cip1) promoter transcription via a mechanism that involves SFN-dependent stabilization of p53 and increased p53 and Sp1 binding to their respective response elements in the p21(Cip1) promoter
22401965 The BRCA1/Chk1/p53 pathway mediated the upregulation of p21(Cip1/Waf1). We also demonstrated that the NO-mediated up-regulation of p21(Cip1/Waf1) was inversely correlated with the activation status of the p38MAPK pathway.
22392074 IGFBP-rP1-induced growth arrest is associated with enhanced expression of the cyclin-dependent kinase inhibitor p21.
22371483 demonstrated that while TFAP2C and Myc can downregulate the CDKN1A promoter independently, KDM5B acts as a corepressor dependent on the other two proteins
22321971 In human breast epithelial cells, androgen receptor signaling requires p21 for MAPK activation.
22320961 p21 (rs733590) C/T SNP was not found to be associated with breast cancer pathogenesis. However, we found that a reverse mutation T/C may be associated with breast cancer occurrence.
22311974 the balance between cancer cell death and arrest after p21 up-regulation depends on the specific effects of p21-induced ROS on the mitochondria.
22296117 FoxM1, p27(kip1) and p21(waf1/cip1) showed distinct immunoreactivity according to histological subtype, which may help in the differential diagnosis of pulmonary neuroendocrine tumours.
22291954 Genetic variations in the cell cycle genes encoding p53 and p21 are associated with idiopathic pulmonary fibrosis disease development and progression.
22282237 Raf-1/JNK /p53/p21 pathway may be involved in apoptosis, and NFkappaB1 may play a possible role in inhibiting apoptosis.
22277651 LCoR recruitment by KLF6 regulates expression of the cyclin-dependent kinase inhibitor CDKN1A gene.
22266309 these data collectively indicate that beta1-integrin-related cell death is closely associated with EMT phenotypes and activation of the p53-p21 pathway is partly involved in the acquisition of resistance to apoptosis induced by beta1-integrin silencing.
22262409 In hepatocellular carcinoma miR-519d is up-regulated by p53 and DNA hypomethylation and targets CDKN1A/p21, PTEN, AKT3 and TIMP2.
22249270 miR-663 modulates cell cycle and proliferation in nasopharyngeal carcinoma by regulating the expression of p21 cyclin-dependent kinase inhibitor.
22244827 Suggest a novel apoptotic mechanism of genetically engineered adenovirus-mediated tumour-specific p53 overexpression through E1A-dependent p21 and MDM2 suppression.
22227369 This work indicates that Zac1 functions are regulated, at least in part, via non-covalent interactions with SUMO-1 for the induction of p21, which is important for the modulation of apoptosis.
22217266 results indicate that STAT1 is implicated in the mediation of Ang II-induced HMC senescence through p53/ p21Cip1 pathway.
22216119 observations disclose PKCdelta as negative regulator of p21(Cip1/WAF1), which facilitates proliferation of insulin secreting cells under stress-free conditions
22214381 RNPC1 contributes to tumor resistance to radiotherapy, which likely occurs through a p21-mediated G/G accumulation mechanism
22211246 NALM-6 cells, which have a higher expression of p21waf1/cip1 mRNA than other leukemia cell lines, were susceptible to spiruchostatin-B-induced cytotoxicity that resulted in induction of apoptosis.
22206000 MEOX1 and MEOX2 activate p16(INK4a) in a DNA binding dependent manner, whereas they induce p21(CIP1/WAF1) in a DNA binding independent manner.
22199295 p53 and CDKN1A genotypes are associated with endometriosis
22190353 DNA-PKCS negatively regulates p21 expression by directly interacting with the p21 transcription machinery via p53, driving the cell towards apoptosis.
22173494 The subcellular localization of P21 may contribute to the development of hepatic cancer.
22172947 These results indicate both cooperative and interdependent roles for ARID3A and p53 in the transcriptional activation of p21(WAF1) in response to DNA damage.
22160829 Widdrol breaks DNA directly in HT29 cells, resulting in checkpoint activation via Chk2-p53-Cdc25A-p21-MCM4 pathway and finally cells go to G1-phase cell cycle arrest and apoptosis.
22147197 Report induction of Fas-mediated extrinsic apoptosis, p21WAF1-related G2/M cell cycle arrest and ROS generation by costunolide in estrogen receptor-negative breast cancer cells.
22135025 Although p21 expression was not correlated with survival incorporating p21 into a multivariable Cox model did contribute to improved model quality for predicting cancer-specific survival.
22117196 Inhibition of Notch3 signalling induces rhabdomyosarcoma cell differentiation promoting p38 phosphorylation and p21(Cip1) expression and hampers tumour cell growth in vitro and in vivo.
22110135 Functional blockade of the voltage-gated potassium channel Kv1.3 mediates reversion of T effector to central memory lymphocytes through SMAD3/p21cip1 signaling.
22101335 Deficiency of p21 reduces Apaf-1 protein expression and inhibits caspase activation in curcumin-treated cancer cells.
22032898 G1-arrest correlates with up-regulation of p21 in oral squamous cell carcinoma cell lines
22012588 DP1, but not DP2, is uniquely involved in the regulation of the p53 and p21Waf1/Cip1 pathway, thereby augmenting senescence in human somatic cells.
22009857 based on our meta-analysis, p21 Ser31Arg polymorphism does not appear to act as an independent lung cancer risk factor
22002313 FIH activity is essential for tumor growth through the suppression of the p53-p21 axis, the major barrier that prevents cancer progression.
22001409 Zac1 is able to interact directly with the Sp1-responsive element in the p21(WAF1/Cip1) gene promoter.
21976111 results indicate that during the cellular response to low UVC fluences the ATR protein kinase up-regulates p21(WAF1/Cip1) and inhibits apoptosis
21956786 Retinoid X receptor antagonist HX531 exerts anti-obesity/anti-diabetes properties by up-regulating the p53-p21 pathway, resulting in G0/G1 cell cycle arrest and the inhibition of cellular hypertrophy of adipocytes.
21938741 Our results suggest a role for variant p21 alt-a in hypoxia and for variant p21B in acute myocardial ischemia
21933903 Describes the structure of a human p53 homotetramer encompassing both the DNA-binding and homo-oligomerization domains in complex with the natural p53-response element present upstream of the promoter of the CDKN1A (p21) gene.
21933447 Studied the regulation of cytoplasmic p21 through transfection of p21 siRNA, Akt2 shRNA and Akt2 constitutively active vector in the two cell lines; their effects on cisplatin-induced apoptosis were evaluated by flow cytometry.
21918011 Epstein-Barr virus Rta-mediated transactivation of p21 and 14-3-3sigma arrests cells at the G1/S transition by reducing cyclin E/CDK2 activity.
21907315 Transfection of siRNA specific for cMet, the HGF receptor, eliminated the HGF anti-proliferation effect on human bone marrow-derived stem cells and the HGF-mediated increase in p53, p21, and p27.
21903579 p53-independent epigenetic repression of the p21(WAF1) gene in T-cell acute lymphoblastic leukemia.
21887277 p21 prevents Puma and its downstream effector Bax from triggering the mitochondrial apoptotic pathway.
21877955 The p21 C31A, Ku80 A2790G, and MDM2 T309G genetic polymorphic variations are associated with the occurrence of head and neck cancer in the Saudi Arabia population.
21875573 The present work shows that SEPW1 facilitates the G1 to S-phase transition by down-regulating expression of the cyclin-dependent kinase inhibitor p21.
21870644 Homozygous deletion of the FHIT gene, p21WAF1 protein expression and apoptosis in bilharzial bladder cancer.
21858171 Results suggest that piroxicam/cisplatin combination might be tested in clinical settings in tumor specimens that express p21.
21820300 4-O-methylhonokiol causes p21-mediated human colon cancer cell growth inhibition through suppression of NF-kappaB.
21804532 3'UTR inhibition and Cebpb mRNA compartmentalization were absent in primary fibroblasts, allowing Ras-induced C/EBPbeta activation and oncogene-induced senescence to proceed.
21791360 Here, the authors report that human papillomavirus type 16 E6 targets the cellular factor p150(Sal2), which positively regulates p21(WAF1) transcription.
21780161 lack of magnesium may increase p21(Cip1) and p27(Kip1) levels mediated by the decrease in ATP content and the activation of p53, resulting in the suppression of cell cycle progression from G1 to S phase in NRK-52E cells
21769863 Data suggest that in some systems p21(CIP) takes part in a mitosis control driving MYC-induced cellular growth into differentiation.
21768776 turnover of p21 was independent of the SCF (skp2) E3 ligase but could be inhibited, at least in part, by reducing hdm2, although this depended on the cell type studied.
21729169 five types of traditional Chinese medicine can attenuate G1 growth arrest of HaCaT cells and dermal fibroblasts induced by UVB exposures, which was caused by down-regulating the expression of cell-cycle regulatory proteins p16, p21 and p53.
21726628 Suppression of Polo like kinase 1 (PLK1) by p21(Waf1) mediates the p53-dependent prevention of caspase-independent mitotic death.
21725088 N-methyl-N'-nitro-N-nitrosoguanidine (MNNG) triggers MSH2 and Cdt2 protein-dependent degradation of the cell cycle and mismatch repair (MMR) inhibitor protein p21Waf1/Cip1.
21709715 Loss of p21 expression was frequently observed in lung cancers and malignant pleural mesotheliomas and aberrant methylation was one of the mechanisms of suppression of p21.
21704589 HBx mutants with changes that correspond to a combination of core promoter mutations up-regulate SKP2, which then down-regulates p21 via ubiquitin-mediated proteasomal degradation, increasing hepatocellular carcinoma risk.
21685936 The results demonstrated that p21 has a critical role in the regulation of the activation of the FA-BRCA pathway and suggest a broader role for p21 in the orchestration of DNA repair following exposure to DNA crosslinking agents.
21677879 Data show that he senescence occurs in the manner dependent on p21.
21666704 RNA-induced activation of p21/CIP1 gene expression inhibited the viability of hepatocellular carcinoma cells and clone formation.
21652709 KLF4-siRNA inhibits PKCdelta-dependent p21(Cip1) promoter activity. PKCdelta increases KLF4 expression leading to enhanced KLF4 interaction with the GC-rich elements in the p21(Cip1) promoter to activate transcription
21642427 the ERK/ELK-1 cascade is involved in p53-independent induction of p21 and BAX gene expression.
21637966 p27 expression seems to be more powerful than p21 expression in providing useful prognostic information in colorectal cancer
21637851 Stress granules component CUGBP1 was identified as a factor required for p21 mRNA stabilization.
21628527 study reports that UBCH8 and UBE2G1 and UBE2G2 cooperate with CRL4Cdt2 in promoting the polyubiquitylation and subsequent degradation of p21 and Cdt1, respectively
21616632 Gefitinib-induced p21 protein stability, rather than increased RNA accumulation, was responsible for the elevated p21 levels
21608063 High p21 and low p53 expression in Inverted Papilloma suggests a non-p53-dependent regulation pathway.
21575583 The different LH subdomains, despite their sequence and thermodynamic differences, play similar roles in binding and inhibiting Cdk2/cyclin A.
21567397 Tension force activates Ras-p38 MAPK pathways in periodontal ligament fibroblasts, which up-regulate p21 and arrest cell cycle progression at the G1 phase.
21565979 Reports the identification of the microRNA miR-22 as a p53 target gene that selectively determines the induction of p53-dependent apoptosis by repressing p21.
21561680 p21 regulates adhesion and microtubule dynamics in untransformed human mammary epithelial cells.
21559393 activation of TP53 and its downstream effectors like CDKN1A by low concentrations of sagopilone is responsible for the relative apoptosis resistance of A549 cells
21554918 Eupatilin inhibits the growth of human endometrial cancer cells via G2/M phase cell cycle arrest through the upregulation of p21.
21552210 We conclude that low p21 and high survivin expression are poor prognosis indicators in FIGO stage I endometrial endometrioid adenocarcinoma
21532626 Data show that in MCF7 cells, both ATM (p53, p21) and ATR (Chk1) pathways are defective leading to a complete lack of G2 arrest in response to bleomycin and ICRF-193.
21526487 The immunoexpression of p21waf1 was lower in the HPV-positive group compared to the HPV-negative group, although only the difference of p53 staining was statistically significant.
21515331 Both sodium selenite and selenomethionine supplementations reduced ROS production, and p53 and p21 activation in MEHP-exposured prostate adenocarcinoma cells.
21478095 Expression of P21 showed no correlation associated with progression in B-CLL
21475302 Data suggest that this novel role of caspase-2 as a translational regulator of p21 expression occurs not only independently of its enzymatic activity but also does not require known caspase-2-activating platforms.
21460037 SKIP is essential for p53 stress-induced expression of the p21
21443127 SNPs of p21 genes were not significantly associated with susceptibility to gastric cancer.
21439247 The p21 31Arg/Arg genotype may serve as a potential marker for increased cancer risk.
21437722 PI3 Kinase inhibition on TRAIL-induced apoptosis correlates with androgen-sensitivity and p21 expression in prostate cancer cells.
21430453 P21 Ser31Arg polymorphism is not associated with cervical cancer.
21419318 phytoestrogens induce apoptotic cell death of ERalpha-negative breast cancer cells via p53-p21-dependent manner.
21417953 The results suggest a role for AP-1 in the proliferation, G(2)/M progression and inhibition of p21 expression in cervical cancer.
21415438 This meta-analysis suggests that the p21 31Arg allele is a low-penetrant risk factor for cancer development, especially among whites.
21402054 Induction of miR-93 expression and reduced p53 binding to p21 gene promoter account for loss of p21(sdi1) expression in senescent cells after DNA damage, suggesting a mechanism of in vivo carcinogenesis in aged tissue without repair arrest.
21383005 these findings describe a novel mechanism whereby EZH2 activation during tumor progression represses p21, leading to suppression of cellular senescence and enhanced tumorigenicity.
21368573 Loss of p21 compromises the p53 transcriptional response in part due to p53 protein mislocalization and that ATM-inhibition gives rise to a similar mislocalization of p53 protein.
21358637 The cyclin-dependent kinase (Cdk) inhibitor p21(Cip1) adaptively binds to and inhibits the various Cdk-cyclin complexes that regulate eukaryotic cell division.
21342417 Data successfully demonstrate the involvement of senescence gene p21 in the expression of stemness markers and osteogenic potential of mesenchymal stem cells.
21336720 Erythromycin could restrain the proliferation of SH-SY5Y cells by downregulating c-myc and upregulating WAF1.
21325480 Hepatitis B virus X protein overcomes trans retinoic acid-induced cellular senescence by downregulating levels of p16 and p21 via DNA methylation.
21325288 the reduction of p21 protein levels plays an essential role in early-stage human papillomavirus-associated lung tumorigenesis and is correlated with poor relapse free survival
21325273 Data show that VentX is a direct transcriptional activator of p53-p21 and p16ink4a-Rb tumor suppression pathways.
21311948 Akt-mediated phosphorylation of p21 and protection of apoptosis are completely abolished by inhibitors of PI3K and Akt.
21292770 Escape from p21-mediated oncogene-induced senescence leads to cell dedifferentiation and dependence on anti-apoptotic Bcl-xL and MCL1 proteins.
21288367 Data show that ECRG4 interacts directly with ECRG1 to upregulate p21 protein expression, induce cell cycle G1 phase block and inhibit cancer cells proliferation in ESCC.
21262772 These findings establish a novel MST3-NDR-p21 axis as an important regulator of G(1)/S progression of mammalian cells.
21245169 Recruitment of BRCA1 to the p53-binding region of the p21 promoter in response to DNA damage required methylation of Arg 754 of p300 by CARM1
21242961 hSSB1 may positively modulate p21 to regulate cell cycle progression and DNA damage response, implicating hSSB1 as a novel, promising therapeutic target for cancers such as hepatocellular carcinoma
21165952 We conclude that Ishikawa cells contain a subpopulation of cells with stem cell-like properties. Musashi-1 modulates endometrial carcinoma cell cycle progression and apoptosis via the stemness-related factors Notch-1, Hes-1 and p21(WAF1/CIP1)
21148311 a new role for 14-3-3gamma in protecting p21 from MDMX-mediated proteasomal turnover, which may partially account for DNA damage-induced elevation of p21 levels independent of p53.
21127431 heterogeneous RB (pRb2 or p16) and p53 (p53, p14, or p21) pathway alterations occur frequently in Burkitt lymphoma
21124069 Strategies to re-express epigenetically silenced p15(INK4b) and p21(WAF1) genes in acute myeloid leukemia.
21115898 Increased frequency of expression of P21 is associated with cirrhosis and hepatocellular carcinoma.
21098705 Data show that DKK-1 knockdown PCa cells exhibited increased expression of the CDK inhibitor p21(CIP1/WAF1) and a 32% increase in G(1) arrest compared with control cells.
21087528 p21 plays a role in lung cancer drug-resistance process
21054888 regulation of p16, p21, p27 and c-myc is increased by oridonin, which induces apoptosis and senescence in colorectal cancer cells
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21046779 The expression of mRNA and protein of Cyclin A in hypertrophic scar changes from high level to low level as the hypertrophic scar develops, while the expression of P21cip1 changes from low level to high level.
21040707 p21, especially cytoplasmic phosphorylated p21, has an oncogenic role in promoting mammary tumorigenesis and metastasis.
20979563 The CDKN1A polymorphism at codon 31 is not a potential risk factor for development of Kaposi's sarcoma in subjects of either African or Caucasian ethnicity.
20979563 Observational study of gene-disease association. (HuGE Navigator)
20966541 p21 deregulation is associated with the activation of stromal fibroblasts of oral cancers by a mechanism that involves the stimulation of SMA expression.
20955243 SPARC regulates, in a cell-autonomous manner, cell cycle progression and proliferation through the p53/p21(Cip1/Waf1) pathway.
20954283 p21 over-expression was found to be associated with poor prognosis in esophageal squamous cell carcinoma.
20890119 Data show that inhibition of ING2 expression accelerates progression of cells from G(1) to S-phase, and is accompanied by a decrease of p21 expression, and that regulation of p21 by ING2 is independent of p53.
20878079 These results suggest c-Myc could further repress p21 expression at the post-transcriptional level through some, but not all, members of miR-17 family.
20858736 Role of Hsp27 in cancer is not only for enhanced p53 proteolysis per se, rather it is also a critical determinant in p21 phosphorylation and translocation.
20844987 A total of 124 of 160 glioma samples displayed CpG island hypermethylation of both p73 and p21 genes associated with the loss of mRNA expression.
20818156 The cyclin-dependent kinase inhibitor p21WAF1/CIP1 is able to influence kinase activities both in a negative and positive manner.
20814747 p21 is a potential mediator of IFN-beta-induced attenuation of telomerase activity and tumor suppression
20813048 Low CIP1 expression is associated with neuroblastoma.
20803550 p21 and p53 are recruited to ALT-associated PML-nuclear bodies after Nutlin-3a treatment, suggesting that they may play a previously unrecognized role in telomere maintenance
20732856 Findings suggest that there is a significant association between the genetic polymorphism of p53, p21, and the risk of cervical cancer among Chinese southern women.
20732856 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20702488 TXL upregulated the protein level of p21 and downregulated the protein levels of MMP-1 and MDR-1
20701798 data suggest that MiTF mediates a survival signal linking Erk1/2 activation and p21 WAF1/CIP1 regulation via phosphorylation on serine 73, which facilitates cell cycle arrest
20668328 Hypermethylation does not contribute to Cip1 silencing in gastric cancer in a northern Brazil population.
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622899 increased levels of PBK/TOPK may contribute to tumor cell development and progression through suppression of p53 function and consequent reductions in the cell-cycle regulatory proteins such as p21.
20600642 Vestibular schwannomas that are merlin deficient exhibit loss of waf1 (p21).
20598695 p21 may function to prevent atherogenesis by regulating the redox balance, which leads to the inhibition of adhesion molecule and chemokine expression in endothelial cells under laminar stress.
20583115 Low expression of p21 may partially explain abnormal epithelial overgrowth in both oral verrucous hyperplasia and carcinoma.
20544840 High CDKN1A is associated with uterine leiomyomas.
20524403 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20510146 p21WAF1/CIP1 may play a role in the inflammation regulation through PPAR transcription factors, strongly linked to lipid metabolism. It could also be involved in the control of the proliferation of monocytes/macrophages. Review.
20510020 Results suggest that SAMD4B is a widely expressed gene involved in AP-1-, p53-and p21-mediated transcriptional signaling activity.
20508865 Reduction of levels of p21Cip1 and p16INK4a could be useful in development of treatments to induce transient cell division to increase corneal endothelial cell density.
20504375 HOXB13 is associated with an additive growth advantage of prostate cancer cells in the absence of or low androgen concentrations, by the regulation of p21-mediated E2F signaling.
20495378 Findings indicate that p21 is a crucial downstream gene target and effector of GATA-1 during red blood cell terminal differentiation.
20466633 Data show that p21WAF1/Cip1 down-regulation was an independent prognostic factor by multivariate analysis.
20458559 p21 and p27 were identified as the primary molecular targets of Arsenic trioxide against breast cancer.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20452353 Lkb1 heterozygosity can accelerate KrasG12D-induced pancratic ductal adenocarcinoma formation through the p53/p21 pathway.
20444901 data suggest low CDKN1A expression in adult T-cell leukemia/lymphoma cells may influence leukemogenesis; abnormal methylation may influence expression of HTLV-1 Tax and also CDKN1A during long-term development of ATLL from HTLV-1-infected T lymphocytes
20433229 These two p21 polymorphisms, both alone and in combination, are not genetic susceptibility biomarkers for esophageal squamous cell carcinoma. Interaction with cigarette smoking may influence the susceptibility to ESCC development in northeastern Iran.
20433229 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20428774 two spontaneously transformed human oral keratinocyte lines from adult human gingival samples revealed a mutation in the p53 gene, loss of p21WAF1/Cip1 and overexpression of p-Rb-Ser807
20419447 Data show that in the presence of a functional p53/Puma/Bax-signaling axis, p14(ARF)-triggered apoptosis is enhanced by loss of p21(CDKN1)-mediated cell cycle checkpoint control.
20388787 ID1 enhances docetaxel cytotoxicity in prostate cancer cells through inhibition of p21
20383190 Using HCT116 somatic knockout cells we show that mechanistically premature APC/C activation depends on p53 and its transcriptional target p21 that mediates the signal through downregulation of the APC/C inhibitor Emi1.
20370687 Data support persistent, p53-independent, p21Cip1 induction as a critical mediator of methylselenic acid-induced G(1) arrest in prostate cancer cells.
20369488 The expressions of P53, P21 and Ki67 proteins are closely related with the pathogenesis and progression of nasal NK/T-cell lymphoma.
20363991 CDKN1A functional polymorphisms may contribute to the risk of colorectal cancer in Turkish
20363991 Observational study of gene-disease association. (HuGE Navigator)
20357201 Observational study of gene-disease association. (HuGE Navigator)
20351180 Results suggest that p400 represses basal p21 gene expression through dual mechanisms that include direct inhibition of TIP60 and ATP-dependent positioning of H2A.Z at the promoter.
20350217 overexpression of p21/WAF1 in osteosarcoma might be one of the poor prognostic factors.
20349127 Meta-analysis suggests that the p21 Ser31Arg polymorphism may be associated with breast cancer development in Caucasian.
20349127 Meta-analysis of gene-disease association. (HuGE Navigator)
20347598 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
20331843 Nucleolar disruption ensures nuclear accumulation of p21 upon DNA damage
20308078 MDM2 promotes proteasomal degradation of p21Waf1 via a conformation change
20303835 p21 regulates the interaction between PARP-1 and base excision repair factors, to promote efficient DNA repair.
20301197 p21Waf1/Cip1 gene expression is induced in estrogen responsive MCF-7 breast cancer cells and Sp1 is involved in the recruitment of ERa to the p21Waf1/Cip1 promoter.
20219912 These data demonstrate that miR-K1 represses the expression of p21, a protein with known tumor suppressor functions, and suggest that this human herpesvirus 8 miRNA is likely to contribute to the oncogenic potential of this virus.
20211058 The anti-tumor mechanisms of genistein may be related with the down-regulation of expression of VEGF and PCNA, and up-regulation of the expression of p21.
20204303 The water extract of the lettuce Lactuca sativa activated checkpoint kinase 2, induced the tumour suppressor p21, and downregulated the proto-oncogene cyclin D1 in HL-60 leukaemia cells and MCF-7 breast cancer cells
20204299 high p21waf-1 or tsp-1 mean expression level comprised small-sized, low-grade, node-negative ductal breast carcinomas
20203690 Binding of G-1 compound to GPR30 in PC-3 prostate cancer cells is followed by sustained activation of Erk1/2 and a c-jun/c-fos-dependent upregulation of p21, resulting in the arrest of PC-3 growth at the G(2) phase.
20193371 The transfer of p21(waf1) and p27(kip1) genes could inhibit the growth of human breast carcinoma cells and the unnormal duplication of centrosomes.
20190815 Gfi-1 is recruited to CDKN1A core promoter through Miz-1 and represses CDKN1A transcription.
20190813 multiple miRNAs that can suppress p21Cip1/Waf1 expression by directly targeting its 3' untranslated region
20190802 NPAT is essential for histone mRNA 3' end processing and recruits CDK9 to replication-dependent histone genes.
20179200 both p21(CIP1/WAF1) and p16(INK4A) are targets for hSNF5 and that p21(CIP1/WAF1) upregulation during hSNF5-induced G(1) arrest precedes p16(INK4A) upregulation.
20169278 No significant differences in protein expression patterns or polymorphisms of CDKN1A in relation to the three types of central nervous system tumors were observed among Brazilian subjects.
20169278 Observational study of gene-disease association. (HuGE Navigator)
20164022 The studies indicate that neither expression of p21 protein nor that of viral NS3 protein can serve as a marker of progression of CH-C to HCC in vivo.
20160708 Results show long-term activation of the checkpoint gene CDKN1A (p21) induces mitochondrial dysfunction and production of reactive oxygen species (ROS) through serial signalling through GADD45-MAPK14(p38MAPK)-GRB2-TGFBR2-TGFbeta.
20154723 the NH2-terminal FATS physically interacts with histone deacetylase 1 (HDAC1) to enhance the acetylation of endogenous p21, leading to the stabilization of p21.
20144199 EBER1 inhibits p21cip1/waf1 transcription and prevents apoptosis through down-regulation of p53, EGR1, and STAT1.
20139077 Transcriptional regulation of p21/CIP1 cell cycle inhibitor by PDEF controls cell proliferation and mammary tumor progression
20127253 The variance in gene p21 a statistically significant association between the SNP measured within p21 and breast cancer status was observed.
20126416 in comparison of Italian centenarians and younger subjects, rare alleles of 2 exon-derived SNPs, rs1801270 and rs1059234, were under-represented in centenarians; these alleles may be detrimental to longevity and therefore are rare in centenarians
20112071 Single nucleotide polymorphism in CIP1 gene is associated with esophageal cancer.
20112071 Observational study of gene-disease association. (HuGE Navigator)
20101223 Overexpression of all these miRNAs rescues HMECs from Ras(G12V)-induced senescence by prevention of Ras(G12V)-induced upregulation of p21(Waf1/Cip1).
20084294 p300 has a direct role in the control of cell growth and differentiation in primary epithelial cells, and p21(Waf1/CIP1) is an important mediator of these p300 functions
20079711 This study provides the first demonstration that TSPYL5 modulates cell growth and sensitization of cells to the detrimental effects of damaging agents via regulation of p21(WAF1/Cip1) and PTEN/AKT pathway.
20071335 there is a p53-independent function of MTA1 in DNA damage response via modulation of the p21 WAF1-proliferating cell nuclear antigen pathway
20067556 The p21 gene is a known transcriptional target of MITF, the reciprocal stimulation of transcription may constitute a positive-feedback loop reinforcing MITF expression in melanoma cells.
20062013 HDM4 is overexpressed in mantle cell lymphoma and, at least in part, exerts its effect by suppressing p21 expression, thereby enhancing cell-cycle progression.
20054616 Data show that upregulation of Spry1 in HUVECs inhibits tube formation and is associated with decreased proliferation and increased expression of p21 and p27.
20039273 Report roles of p16(INK4A) and p21(WAF1) in replicative senescence and ionizing radiation-induced accelerated senescence in human normal, ataxia telangiectasia and Li-Fraumeni syndrome fibroblast strains.
20025780 The proteins p53, p21/WAF1, and MDM2 were overexpressed in all the hepatocellular carcinoma cases in this study.
20018861 hGTSE-1 mediated-p21(CIP1/WAF1) stabilization is clearly involved in the ability of cells to counteract cytotoxicity induced by the microtubule poison paclitaxel.
20012529 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
20006705 stimulatory effect of deltaEF1 on cell proliferation through p21 regulation is supported by an inverse correlation of deltaEF1 and p21 expressions in breast cancer cell proliferation.
19958256 The antioxidant quercetin inhibits cellular proliferation via HIF-1-dependent induction of p21WAF.
19956888 p21Waf1/Cip1 cleavage, which is mediated by caspase-3 activity, is involved in roscovitine-induced apoptosis
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19955391 Genetic polymorphisms of p21 is associated with second primary malignancy in patients with index squamous cell carcinoma of the head and neck.(
19955391 Observational study of gene-disease association. (HuGE Navigator)
19950226 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19935879 Data suggest that wogonin induced G1 phase arrest in HeLa cells by modulating several key G1 regulatory proteins, such as Cdk4 and cyclin D1, as well as up-regulation of a p53-mediated p21Cip1 expression.
19931389 effects of progesterone metabolites on cell proliferation, mitosis, apoptosis and expression of Bcl-2, Bax and p21
19923826 Using the chi square test ( table 2 ) the expressions of GST-pi (p = 0.003), Neu/Her-2 (p = 0.017), and p21 (p = 0.034) in cardiac cancer were significantly higher than those in distal gastric cancer.
19921577 Expression of cyclin D1 and P21WAF1 is related to drug-resistance of gastric cancers.
19914103 Loss of cip1 protein is associated with intravesical recurrence following transurethral resection in in non-muscle-invasive bladder cancer.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910837 Results indicate that the p21 polymorphism may contribute to susceptibility to pancreatic cancer, particularly among p27 homozygous wild-type carriers and nonsmokers.
19910837 Observational study of gene-disease association. (HuGE Navigator)
19895794 These data together show that p21 translocates to the nucleus to participate in DNA repair, while the rest is rapidly degraded in the cytosol.
19860623 increase in CDK6, Cyclin E, p27kip1, and p21waf1 expression, and after 6BIO treatment, the expression of most of these proteins decreased.
19855935 This study shows that the activation of the p53-p21(Cip1/WAF1) pathway acts as a major mediator of cellular senescence induced by CKII inhibition.
19840446 Expression of P-gp was reduced along with increasing concentration of tetrandrine in K562 cells.
19822666 Data suggest thta MST kinases 1/2 serve to monitor cytoskeletal integrity and couple the JNK1/SAPK1 pathway to the regulation of the cell cycle regulatory protein p21Waf1.
19820361 P21 Codon 31 with AGA (Arg) allele is a genetic risk factor of cervical squamous cell carcinoma.
19820361 Observational study of gene-disease association. (HuGE Navigator)
19819988 analysis of BMP-4 induction of arrest and differentiation of osteoblast-like cells via p21 CIP1 and p27 KIP1 regulation
19818775 Growth-inhibitory effect of let-7a on the A549 cells in vitro and in vivo may be explained in part by le-7a-induced suppression of NIRF and elevation of p21(WAF1).
19802676 Chondrocytes in cartilage biopsies of ACH children were characterized by the presence of growth arrest mediated by STAT(signal transduction and transcription) activation and increased expression of p21(p21CIP1) and cyclin D1
19798054 AP-2gamma promotes proliferation in breast tumour cells by direct repression of the CDKN1A gene.
19795398 Fndings suggest that the selected polymorphisms of p21, CCND1, and caspase8 may not contribute to the risk of colorectal cancer.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19773351 p21(WAF1) can induce thioredoxin secretion and angiogenesis in cancer cells, by direct transcriptional repression of the thioredoxin-binding protein 2 promoter
19750108 Observational study of gene-disease association. (HuGE Navigator)
19738611 Observational study of gene-disease association. (HuGE Navigator)
19732026 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
19730150 Data show that Protein levels of tumor suppressor targets of the miRNAs were increased by antisense to miR-21 (PTEN and RECK) and miR-221 (p27).
19723627 Androgen via p21 inhibits tumor necrosis factor alpha-induced JNK activation and apoptosis
19723093 Data show that kidney bean husk extract exhibited antitumor effects accompanied by the increase in p-AMPK and p-Acc as well as antitumor proteins p53 and p21.
19723065 Data show that the inhibition of cell proliferation with L.lac CF was associated with an increase in p53 and p21 expression, the reduction of cyclin D1 expression, and retinoblastoma protein phosphorylation.
19713748 regulation of p21 intracellular distribution is a new mechanism for BCCIP to modulate p21 functions
19693773 JNK activation is involved in the terbinafine-induced inhibition of ERK phosphorylation, p53 and p21 up-regulation and DNA synthesis inhibition in HUVEC
19692168 Observational study of gene-disease association. (HuGE Navigator)
19686092 APPL1 overexpression affects the composition of the HDAC1-containing NuRD complex and the expression of HDAC1 target p21WAF1/CIP1
19672706 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19670700 Immunoreactivity index of p21 and cyclin D1 is independent of the morphological pattern of human endometrium, patients' age and gynaecological history of patients.
19668373 the homeodomain-interacting protein kinase-2 (HIPK2) and p53 were found activated along a pro-apoptotic signalling pathway while p21(waf1,cip1,sdi1) was prevented from its protective action
19667069 ROCK-mediated up-regulation of p21(Cip1) and the cytoskeleton in PKCdelta-dependent apoptosis in prostate cancer cells.
19664338 P21WAF1 protein may be related to the malignant development of epithelial ovarian cancer. CDK1 expression was negatively correlated to P21WAF1 expression.
19657726 down-regulation of p21 was strongly associated with HPV-18 positive cervical carcinomas
19657064 zinc deficiency differentially modulated the Akt-Mdm2-p53 signaling axis in normal prostate cells vs. the Akt-p21 signaling axis in malignant prostate cells.
19643983 In several paired samples before and after F-refractory disease, no change in p21/p53 induction was observed after DNA damage.
19638413 The increased levels of p53 in post-selection human mammary epithelial cells are due to the presence of an Mdm2 fragment that binds p53 but does not result in its degradation.
19635457 These data clearly demonstrate that ITF-2A regulates CDKN1A transcription.
19629483 Data show that NTD upregulated the expression levels of apoptosis related genes p53, BAX and p21 in A549 cell line.
19628749 Among human cancers, sebaceous carcinoma of the eyelid may be one of those showing most frequent mutation of the p53 gene, which may not be caused by exposure to UV. p21(WAF1/CIP1) downregulation may be associated with lymph node metastasis.
19626602 Observational study of gene-disease association. (HuGE Navigator)
19581932 CTIP2 is a constitutive p21 gene suppressor that cooperates with SUV39H1 and histone methylation to silence the p21 gene transcription.
19581932 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
19578553 study found no link between polymorphisms in APOE, p53, and p21 genes and primary open-angle glaucoma in Turkish patients,although a larger sample is required to elucidate the role of these polymorphisms in the pathogenesis and course of glaucoma
19572978 over-expression of DIXDC1 might target p21 and cyclin D1 to promote colon cancer cell proliferation and tumorigenesis at least partially through activation of the PI3K/Akt pathway.
19550124 Data show that DADS induces G(2)/M arrest in colon cancer SW480 cells, probably through the downregulation of PCNA, p53 and cyclin B1 and upregulation of p21(WAF1).
19541625 results provide evidence for a new regulatory loop involving the NER protein DDB2, Mdm2, and p21(Waf1/Cip1) that is critical in deciding cell fate (apoptosis or arrest) upon DNA damage.
19538940 PP2Cgamma is a novel regulator of p21(Cip1/WAF1) protein stability via the Akt signaling pathway.
19536131 Data indicate that MKRN1 is a novel modulator of p53 and p21, preferentially leading cells to p53-dependent apoptosis by suppressing p21.
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19528229 Data show that inhibition of p38 MAPK and its phosphorylation of HuR impairs p21(Cip1) accumulation and, as a result, the ability of cells to arrest in G(1) in response to gamma radiation.
19513497 Combination of p53 expression and p21 loss has an independent prognostic impact on sporadic colorectal cancer.
19505915 polymorphisms in p21 may be protective against the risk of chronic benzene poisoning in the Chinese occupational population.
19505915 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19502805 TheCyclin-Dependent Kinase Inhibitor p21 cooperate to determine sensitivity to DNA damage following chk 2 inhibition and that chk 2 modulates the biological rheostat that determines whether a cell undergoes arrest versus death.
19491398 ZBTB5 directly repressed transcription of cell cycle arrest gene p21 by binding to the proximal GC-box 5/6 elements and the two distal p53-responsive elements (bp -2323 to -2299; bp -1416 to -1392)
19491257 describes a third abnormal response pattern characterized by failure of p21 protein accumulation despite a normal p53 protein response
19487575 ablation of the protein kinase Chk1 rescues the p21 transcription elongation defect when cells are blocked in S phase
19481339 Cyclosporine A inhibits colorectal cancer proliferation probably by regulating expression levels of c-Myc, p21(WAF1/CIP1) and proliferating cell nuclear antigen.
19465904 inactivation of p21(WAF1/CIP1) checkpoint function occur in low-grade dysplastic lliver nodules as well as in high-grade liver dysplastic nodules in patients with chronic B viral cirrhosis
19465901 the expression of p53, p21 and RB was not significantly different in penile verrucous carcinoma than in usual type squamous cell carcinoma.
19458054 Results suggest that adenovirus-mediated transduction of p53 and p21-specific microRNAs may be useful for gene therapy of human cancers.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19452712 The expressions of p53, p21 and Ki67 proteins are closely related with the pathogenesis and progression of nasal NK/T-cell lymphoma.
19435914 NORE1A activates p21(CIP1) via promoting p53 nuclear localization.
19409758 Letter: Inhibition of protein kinase CK2 induces E2F1 nuclear export, formation of p21/E2F1 complexes and suppression of DNA synthesis in normal human epidermal keratinocytes.
19407849 The observations suggest that p21(WAF1) plays a role in mediating replication of oncolytic viruses with potential implications for adenoviral therapy of cancer.
19384944 dsRNA mediated gene activation is demonstrated in renal cell carcinoma and suggests that forced over-expression of p21 may lead to an increase in apoptosis through a survivin dependent mechanism
19383287 ectopic Meox2 suppressed epithelial cell proliferation in cooperation with TGF-beta1, and mediated induction of the cell cycle inhibitor gene p21.
19367277 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19364816 ERK2 activation transduces mitogenic signals, at least in part, by downregulating the cell cycle inhibitory protein p21(Cip1).
19356250 Tax increases p21 mRNA expression by transcriptional activation and mRNA stabilization
19339270 Observational study of gene-disease association. (HuGE Navigator)
19332548 The degradation of p21(Cip1) and other targets of the Cul4-DDB1(Cdt2) E3 ligase may collectively contribute to the survival of neoplastic cells after ionizing radiation.
19330811 The Bax activator BimEL increased rapidly, driving cells towards apoptosis likely controlled by c-Myc and p21(WAF1) activities.
19329556 Diesel particle-induced transcriptional expression of p21 involves activation of EGFR, Src, and Stat3
19322654 An inhibition of cell proliferation associated with upregulation of p21(Cip1/WAF1) was observed following transfection of DUOXA1
19322021 SHP induced the cell cycle regulatory protein levels and cooperatively increased an induction of p21WAF1 expression with p65.
19321391 Results indicate that degradation of p21 is not dependent on a particular DNA repair pathway, and is not required for efficient DNA repair.
19305381 p21(Cip1/WAF1) overexpression is an excellent favorable prognosticator in tonsillar squamous cell carcinomas
19276356 Data provides a novel mechanism for transcription activation by FOXP3 and a genetic mechanism for lack of p21 in a large proportion of breast cancer.
19276188 p31(comet) induces tumor cell senescence by mediating p21(Waf1/Cip1) accumulation and Mad2 disruption and that these effects are dependent on a direct interaction of p31(comet) with Mad2.
19275888 p21(WAF1)-p300-DNMT1 pathway may play a pivotal role to ensure regulated DNMT1 expression and DNA methylation in mammalian cell division.
19273588 Results establish a new role for H2AX in the p53/p21 pathway and indicate that H2AX is required for p21-induced cell cycle arrest after replication stalling.
19269967 increases of p16(INK4a) and p21(WAF1/cip1) expression in response to BMP4 were mediated by the Smad1/5/8 signaling pathway.
19263441 Data show that the growth inhibitory effects of the glyceollins appeared to be due to an inhibition of G1/S progression and correlated with an up-regulation of cyclin-dependent kinase inhibitor 1 A and B mRNA and protein levels.
19262578 Study concludes that the minor allele A at -899 of CDKN1A is associated with increased susceptibility to systemic lupus erythematosus and lupus nephritis, and decreased cellular levels of p21.
19262578 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19258477 Observational study of gene-disease association. (HuGE Navigator)
19249676 MDM2 released from p53 by RITA promotes degradation of p21 and the p53 cofactor hnRNP K, required for p21 transcription
19243472 Results suggest that loss of IKKbeta activation is important for the enhancement of p53 stability, leading to p21 expression and cell cycle arrest and apoptosis of tumour cells.
19237173 Observational study of gene-disease association. (HuGE Navigator)
19224585 Observational study of gene-disease association. (HuGE Navigator)
19223555 RASSF1A can mediate cell cycle arrest and senescence in human cancer cells by p53-independent regulation of p21(Cip1/Waf1).
19221506 nucleophosmin as a positive post-translational regulator of p21.
19211842 Emi1 down-regulation and APC activation leads to stable p21-dependent G2 arrest after DNA damage.
19211566 reveal a pivotal role for alphaCP1 and alphaCP2 in a p53-independent pathway of p21(WAF) control and cell cycle progression
19177004 Data demonstrate that the long-term suppression of Plk1 increases the levels of cyclin-dependent kinase inhibitor p21(WAF1/CIP), which is partially induced by the elevated tumor suppressor p73 in p53-inactivated HeLa cells.
19176530 Oxidative Stress Increases the Number of Stress Granules in Senescent Cells and Triggers a Rapid Decrease in p21waf1/cip1 Translation.(
19176223 The p21 codon 31*C- and DRD2 codon 313*T-related genotypes/alleles, but not XRCC1 codon 399, hOGG1 codon 326, and DRD1-48 polymorphisms, are correlated with the presence of leiomyoma.
19176223 Observational study of gene-disease association. (HuGE Navigator)
19161984 The results provide support for a model whereby p21 downregulation promotes vinblastine-induced apoptosis by alleviating its protective function following mitotic arrest.
19159630 Results describe thet role of P53/P21 and RUNX 3 in the effects of 5-Aza-2'-deoxycytidine on human cancer cells.
19141585 Observational study of gene-disease association. (HuGE Navigator)
19134409 The PKCalpha-ERK1/2 cascade is involved in PMA induced up-regulation of cyclin D1 and P21(cip1) and proliferation in human airway smooth muscle cells.
19129183 vIRF-3 antagonized IRF-5-mediated activation of the p21 promoter.
19125693 hCASK regulation of cell growth might involve p21 expression, and that the bHLH (basic helix-loop-helix) transcription factor E2A probably participates in hCASK regulation of p21 expression
19124506 Observational study of gene-disease association. (HuGE Navigator)
19122196 1alpha,25-dihydroxyvitamin D(3) regulates p21 transcription by inducing cyclical chromatin looping that depends on both histone deacetylation and demethylation.
19106607 These results highlight the role of p21 in counteracting inappropriate proliferation stimuli for genome stability maintenance.
19102934 After treatment of HepG2 cells with DOX, the expression of p53 and p21 was increased, whereas that of survivin was reduced during 24 hours of the treatment.
19096232 These results showed that the expression of cyclin D1, p21 and p27, alone or in combination, are early events in gastric tumorigenesis and may serve as a candidate molecular marker for the early gastric carcinoma.
19091404 Notch-1 may be mediated through regulating the expression of cell cycle regulatory proteins cyclin D1, CDK2 and p21 and the activity of Akt signaling
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19058005 Expression of cyclin E could not predict survival in patients with gastric cancer, whereas the expression of pRb and p21 was associated with a favorable prognosis.
19041685 Bortezomib arrests the proliferation of hepatocellular carcinoma cells HepG2 and JHH6 by differentially affecting p21 level.
19033664 a mechanistic link between JNK activity and liver cell proliferation via p21 and c-Myc and suggest JNK1 targeting can be considered as a new therapeutic approach for HCC treatment.
19002614 Gene and protein expression of p53 and p21 in fibroadenomas and adjacent normal mammary tissue.
19001415 Monocytic leukemia zinc finger (MOZ) interacts with p53 to induce p21 expression and cell-cycle arrest.
18981726 Compounds which attenuate p21 cause renal cell carcinoma cell apotosis and sensitize these cells to DNA-damaging chemotherapy.
18979138 Absence of p21 expression is associated with biologically less aggressive phenotypes in gallbladder and extrahepatic bile duct cancer.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18949380 TsA markedly down-regulated the expression of cyclin D1 and CDK4, up-regulated the expression of p21WAF1 and p53 and induced cell cycle arrest at the G1 phase in MCF10A-ras cells
18948188 protects against oxidative stress by suppressing ER-dependent activation of mitochondrial death pathways
18941111 CDKN1A/p21 appears to be an essential target of miR-17-92 during B-cell lymphomagenesis, which suggests the miR-17-92 polycistron has distinct targets in different B-cell lymphoma subtypes.
18923142 Results indicate that both p16(INK4a) and p21(WAF1/CIP1) are required for the opioid growth factor (OGF)-OGF receptor axis to inhibit cell proliferation in normal cells.
18852884 knockdown of endogenous MBP-1 is involved in cellular senescence of HFF through p53-p21 pathway.
18850004 HDAC4 interacts with Sp1, binds and reduces histone H3 acetylation at the Sp1/Sp3 binding site-rich p21(WAF1/Cip1) proximal promoter, suggesting a key role for Sp1 in HDAC4-mediated repression of p21(WAF1/Cip1).
18842998 p21 mRNA expression in vinyl chloride exposed workers was significantly higher than in nonexposed workers.
18842998 Observational study of gene-disease association. (HuGE Navigator)
18829543 Tbx2 and Tbx3 may play a dual role during the radial to vertical growth phase transition by both inhibiting senescence via repression of p21(CIP1) expression, and enhancing melanoma invasiveness by decreasing E-cadherin levels.
18823025 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18818310 AP4 directly repressed p21 by occupying four CAGCTG motifs in the p21 promoter via its basic region.
18806827 Cooperative effect of p21Cip1/WAF-1 and 14-3-3sigma on cell cycle arrest and apoptosis induction by p14ARF
18798266 p21(WAF1/CIP1) is an important factor in the sensitivity of cells to the growth inhibiting and apoptotic effects of OSU03012.
18794348 defines the degradation of p21 as a critical aspect of replication licensing in human cells
18794347 PCNA promotes the ubiquitylation and degradation of the CDK inhibitor p21 in cells irradiated with low dose of ultraviolet radiation
18791688 positive expression rate and co-expression rate of P21WAF1/CIP1 and P16 proteins could reflect the malignant grade of glioma to some extent, and they can be considered as a sensitive index for glioma grading
18790797 Increased expression of p21/WAF/Cip1 in primary leukemic blasts suggests that elevated p21/WAF/Cip1 levels may contribute to specific features observed in AML1-positive leukemia.
18788572 The C/C genotype of p21 may reduce the risk of epithelial endometrial cancer.
18788572 Observational study of gene-disease association. (HuGE Navigator)
18782865 p21 is a negative regulator of PCNA-pol eta interaction.
18766473 the analysis of p21cip1, p27kip1, and p16INk4a by immunohistochemistry could be useful in the management of patients with papillary thyroid carcinoma
18765563 These results shed light on the molecular mechanism of action of GHRH antagonists in tumor tissues and suggest that the antineoplastic activity of GHRH antagonists could be considered for the treatment of cancers expressing p21.
18719376 The p53-dependent transcriptional regulation of p21 in response to DNA damage by ultraviolet radiation and ionizing radiation compared.
18713757 experiments showed that p21 deficiency in stromal fibroblasts accelerates breast tumor growth through cell non-autonomous mechanism(s); propose that p21 regulation is intimately linked with the ability of stromal cells to affect tumor growth
18710616 Sodium butyrate could induce G1 arrest and inhibit cell proliferation in AGS cells by up-regulating the expression of p21.
18703516 CDK inhibitor p21 is degraded by a proliferating cell nuclear antigen-coupled Cul4-DDB1Cdt2 pathway during S phase and after UV irradiation
18698027 p21 might play an important role in chemosensitivity to anticancer agents
18694622 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18664350 Radix notoginseng extracts may inhibit the proliferation and promote the apoptosis of precancerous gastric cells through altering expressions of the bcl-2, Bax and p21WAF1 genes.
18655775 Deletion of NLS motifs resulted in failure of ING1b to completely localize to the nucleus and inhibited its ability to induce p21WAF1 expression.
18644983 Zac1 might be involved in regulating the p21(WAF1/Cip1) gene and protein expression through its protein-protein interaction with p53 and HDAC1 in HeLa cells.
18632985 HDAC4 is a novel regulator of colon cell proliferation through repression of p21
18619950 Andrographolide inhibits human colorectal cancer Lovo cell growth by G1-S phase arrest and inducing the expression of p53, p21 and p16.
18593937 Activation of protein kinase G Increases the expression of p21CIP1, p27KIP1, and histidine triad protein 1 through Sp1.
18583941 Simultaneous knock-down of both p21 and p27 significantly enhanced doubling time, clonogenicity and cell cycle progression in a prostate cancer cell line.
18563330 p21 could be a potential mediator of survivin suppression at the transcriptional level
18562088 The procyanidin-mediated induction of apoptosis and cell-cycle arrest in esophageal adenocarcinoma cells is not dependent on p21(Cip1/WAF1).
18559599 The combined phenotype of RHAMM and p21 expression is an invaluable independent prognostic immunohistochemical profile in microsatellite instability-high colorectal cancer.
18546941 Our study has identified p21 protein expression as important biological marker which may indicate the progression of laryngeal squamous cell carcinoma.
18509005 crucial role exerted by p21Cip1/WAF1 in PPARgamma action in thyroid neoplasm
18508827 haem oxygenase-1 plays a central role in NNK-mediated cell proliferation by promoting the expression of p21(Cip1/Waf1/Cid1), inhibitor of apoptosis protein 2 and B-cell lymphoma-2 but inhibiting the activity of Bad
18507837 Observational study of gene-disease association. (HuGE Navigator)
18498065 Genetically programmed cell death is related the p21 and p27 pathways in pseudophakic bullous keratopathy.
18463164 S100A11 targets Rad54B to sites of DNA DSB repair sites and has a role in p21-based regulation of cell cycle
18459109 Observational study of gene-disease association. (HuGE Navigator)
18458079 Cdc6 determines utilization of p21(WAF1/CIP1)-dependent damage checkpoint in S phase cells
18456456 oxidative stress-induced expression in biliary epithelial cells in primary biliary cirrhosis is associated with activation of the ATM pathway
18451802 Zbtb4 associates with the Sin3/histone deacetylase co-repressor and represses expression of P21CIP1 as part of a heterodimeric complex with Miz1.
18441278 p21, acting as a sensor of cellular stress, may have potent and wide roles in lung responses triggered by cigarette smoke. [REVIEW]
18427550 increased expression of p21(Waf1/Cip1) and several other p53-regulated genes is caused by diminished Pdcd4 expression
18413741 Genistein induces the expression of tumor suppressor genes p21 (WAF1/CIP1/KIP1) and p16 (INK4a) with a concomitant decrease in cyclins in prostate cancer cells.
18400748 disruption of the spindle-assembly checkpoint does not directly influence p53 activation, but the shortening of the mitotic arrest allows cyclin E-CDK2 to be activated before the accumulation of p21(CIP1/WAF1).
18386236 Mutations of K-ras and overexpression of the ras p21 were detected in 11% and 76% of the colorectaltumors, respectively
18385759 S100/A11 and p21 gene expression was also found to be significantly lower in acute and chronic atopic dermatitis skin.
18385383 results support Killin as a missing link between p53 activation and S phase checkpoint control designed to eliminate replicating precancerous cells, should they escape G(1) blockade mediated by p21.
18374497 CDKN1A expression increased with increasing grade in meningiomas.
18361427 Observational study of gene-disease association. (HuGE Navigator)
18358634 Report overexpression of cyclin D1, D3, and p21 in renal carcinomas with Xp11.2 TFE3-gene fusion.
18353898 High zinc status in normal bronchial epithelial cells upregulates p53 expression which in turn elevates p21, inducing G2/M blockage.
18348176 variations in c-myc and p21(WAF1) expression delay apoptosis making PBL resistant to sodium butyrate for several hours
18339845 BAF180 suppresses tumorigenesis, at least in part, through its ability to regulate p21.
18334933 p16(INK4a), p21(WAF1/CIP1), p27(KIP1), and p53 are expressed in human corneal endothelial cells despite donor ages.
18316600 ERK and JNK MAPK/Elk-1/Egr-1 signal cascade is required for p53-independent transcriptional activation of p21(Waf1/Cip1) in response to curcumin in U-87MG human glioblastoma cells
18298387 the p21G251A polymorphism significantly correlates to the subgroup of locally advanced breast cancers (p = 0.0049)
18292944 CARF exerts a vital control on the p53-HDM2-p21WAF1 pathway that is frequently altered in cancer cells.
18281541 Observational study of gene-disease association. (HuGE Navigator)
18281511 Defective p53 signaling in p53 wild-type tumors attenuates p21waf1 induction and cyclin B repression rendering them sensitive to Chk1 inhibitors that abrogate DNA damage-induced S and G2 arrest.
18278446 intracellular accumulation of P21WAF1 may be one of the mechanisms which contribute to cigarette smoke extract-induced inhibition of cell proliferation
18251939 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18251939 present study did not demonstrate a significant association between P21 / WAF1 genotype and oral squamous cell carcinoma
18243530 We propose that BARD1 reduces BRCA1 transcriptional activity, and that this at least partly involves BRCA1/BARD1 E3 ubiquitin ligase activity, which is disrupted by the C61G mutation.
18230337 Our results indicate that nicotinamide treatment attenuates p21WAF1 expression through Sp1 downregulation, and suggest a possible involvement of nicotinamide metabolism in cellular gene expression.
18226366 Observational study of gene-disease association. (HuGE Navigator)
18215742 PUMA exerts a negative feedback on p53 and p21, leading to p21-dependent growth suppressive and survival changes.
18212054 p21 is a direct target of miR-106b. Its silencing plays a key role in miR-106b-induced cell-cycle phenotypes.
18205772 Observational study of gene-disease association. (HuGE Navigator)
18203777 Reduced expression of p21 could be a helpful diagnostic marker and may contribute to the invasive phenotype of Small-cell neuroendocrine carcinoma of the uterine cervix.
18202757 the -KTS-containing variants of WT1 are directly involved in the regulation of p21(Waf1/Cip1) expression and the subsequent suppression of lymph node metastasis in human lung squamous cell carcinoma
18181833 We immunohistochemically analyzed the expression of p21, p27, p14, p16, p53 and proliferation marker Ki67, in 67 low and high grade astrocytic tumors.
18174243 Observational study of gene-disease association. (HuGE Navigator)
18174230 Observational study of gene-disease association. (HuGE Navigator)
18172194 p21Cip1 is prominent within the dentate gyrus and restricted to the subgranular zone of the developing transgenic p21-deficient mouse dentate gyrus, where it might act to restrain neurogenesis.
18166158 These results imply that HIF-1alpha functions as an up-stream player in the p21-mediated growth arrest of keratinocytes.
18162533 loss of p21's cyclin-dependent kinase inhibitory property results in hyperphosphorylation of estrogen receptor-alpha, with subsequent increased gene expression of estrogen receptor-regulated genes
18162471 discrete PKCs trigger distinctive responses when activated in different phases of the cell cycle via a common mechanism that involves p21 Cip1 up-regulation.
18156402 The expression of p21(WAF1/Cip1) and p27(Kip1) was increased at both protein and mRNA levels by hydroxytyrosol, a main phenol of olive oil.
18097575 linear relationship and prognostic role of the p53/p21/PCNA pathway in gastrointestinal stromal tumors. Abnormalities of the p53/p21WAF1 pathway lead to increased proliferating states, thereby triggering the progression of GISTs.
18086887 These results demonstrate that MDMX and MDM2 independently and cooperatively regulate the proteasome-mediated degradation of p21 at the G(1) and early S phases.
18071305 Orphan nuclear receptor estrogen-related receptor-beta suppresses in vitro and in vivo growth of prostate cancer cells via p21(WAF1/CIP1) induction.
18067855 The culture of cells in the Cl(-)-replaced medium significantly increased expressions of p21 mRNA and protein without any effects on p53.
18049450 TP53 Arg72Pro polymorphism, but not p73 G4C14>A4TA4 and p21 Ser31Arg, contribute to risk of cutaneous melanoma
18046503 Results suggest that a combined analysis of three P21 polymorphisms might better predict the risk of lung cancer than the analysis of a single polymorphism.
18035504 levels of p53/p21waf1 mRNA in blood lymphocytes collected before chemotherapy may predict the chemoresponses of lung cancer patients.
18025091 the ability of Tbx2 to repress the p21 gene is enhanced in response to a stress-induced senescence pathway, which leads to a better understanding of the regulation of the anti-senescence function of Tbx2.
18024214 p21 has an important role in the cellular response to normal replicative stress and its absence leads to a "chronic DNA damage" state that primes the cell for p53-dependent apoptosis.
18004740 ERK activation with some other pathway(s), activated through the HGF receptor, are required to up-regulate p16 and p21 expression, that of p21 contributes to suppression of Cdk2 activity leading to inhibition of proliferation of HGF-treated HepG2 cells.
17972508 The combination of p53 and p21 expressions in biopsy findings can thus predict the histological effectiveness of hyperthermochemoradiotherapy.
17952758 There were no apparent differences in immunostaining for p21 in myomas or in normal myometrium
17941827 that Rac1 is an essential player for mediating the induction of cyclin D1 and p21(Cip1) by HRG in breast cancer cells
17937105 cell cycle inhibitor p21Waf1/Cip1 genes were found significantly upregulated in the cases with progressive sarcoidosis
17925548 Observational study of gene-disease association. (HuGE Navigator)
17920036 Both PD98095 and dicoumarol were capable of blocking TNFalpha production but had only a small effect on p21Waf1 expression
17911387 Our results point to an antiproliferative function of the unliganded ER alpha through its physical interactions with p21(WAF1) that may also explain the favorable prognosis of ER alpha-positive breast cancers.
17894409 Nuclear accumulation of p21 accompanied by accelerated senescence may be an integral component of the response of human fibroblasts to UVC-induced DNA damage, irrespective of their DNA repair capabilities.
17885207 Results found that the activation of p21 is primarily by HNF4alpha1 interacting with promoter-bound Sp1 at both the proximal promoter region and at newly identified sites in a distal region (-2.4 kb)and does not need direct DNA binding by HNF4alpha1.
17873065 TLX recruits histone deacetylases to repress transcription of p21(CIP1/WAF1) and pten and regulate neural stem cell proliferation
17855660 p21Cip1/WAF1 can be phosphorylated by Pim-1 kinase in vitro, implying that part of the function of Pim-1 might involve influencing the cell cycle.
17804869 15-48 aa region of p21 is essential for basal expression by preventing degradation by the proteasome
17721438 Data show that knockdown of p21Cip1, but not p16(INK4a) or Rb, allows cells to bypass premature senescence that is induced by BS69 knockdown.
17700068 Study reports that p18(Hamlet) can also mediate the cell cycle arrest induced in response to gamma-irradiation, by participating in the p53-dependent upregulation of the cell cycle inhibitor p21(Cip1) (CDKN1A).
17692879 The apoptogenic activity of BM-ANF1 was mediated through p53 tumor-suppressor gene expression followed by the expression of p21(Cip1) and p27(Kip1)linking it with cell cycle arrest at G1 phase in cancer cells.
17686574 ectopically BRCA2-expressing cells have different intracellular levels of Aurora A, Aurora B, p21, E2F-1, and pRb, suggesting a BRCA2-mediated suppression of polyploidy via stabilization of the checkpoint proteins levels
17684142 Observational study of gene-disease association. (HuGE Navigator)
17682292 Data indicate that overexpression of the transcriptional cofactor FHL2 contributes to breast cancer development by mediating transcriptional activation of MAPK target genes known to be involved in cancer progression, such as p21.
17671727 Treatment with Magnolia plant extracts upregulated epression of this protein in a bladder cancer cell ilne.
17671689 type I IFN prolongs cell cycle progression by p21WAF1/CIP1 induction in human colon cancer cells
17671089 Upon DNA damage, histone H2A.Z is first evicted from the p21 promoter, followed by the recruitment of the Tip60 histone acetyltransferase to activate p21 transcription.
17662641 Downregulation of caveolin-1 expression affects bleomycin-induced cell cycle arrest and subsequent cellular senescence that is driven by p53 and p21.
17656367 p21WAF1/CIP1 is a common transcriptional target of retinoid receptors RAR and RXR
17641414 Elevated expression of cell-cycle regulators p16(INK4A), p21(CIP1), and cytoplasmic/nuclear beta-catenin correlated with increased colorectal cancers risk, as did elevated expression of survivin and human telomerase reverse transcriptase.
17638911 Histone deacetylase inhibitors enhance lexatumumab-induced apoptosis via a p21Cip1-dependent decrease in survivin levels
17627285 Rhabdomyosarcoma cells overexpressing MDM2 abrogated ceramide-mediated p21(Cip1/Waf1) induction, G(2) arrest and the late ensuing apoptosis.
17619016 Data show that functional cooperation between TrkA and p75(NTR) accelerates neuronal differentiation by increased transcription of GAP-43 and p21(CIP/WAF) genes via ERK1/2 and AP-1 activities.
17617120 Overexpression of p21/WAF1 is an independent prognostic factor in hepatocellular carcinoma which favors survival.
17616661 PKC epsilon exerts its oncogenic activity through deregulation of the cell cycle via a p21/Cip1-dependent mechanism
17611661 Low expression of p21 was detected but had no effect on survival or recurrence in the univariate analysis.
17606716 TSG101 negatively regulates p21 levels, and up-regulation of TSG101 is associated with poor prognosis in ovarian cancer
17595776 Observational study of gene-disease association. (HuGE Navigator)
17595776 The association of p53 codon 72 and CDKN1A codon 31 polymorphisms with oral cancer risk in a Taiwanese population were investigated.
17592292 Ski siRNA increased TGF-beta-induced Smad2 phosphorylation and p21 expression.
17585201 p21 acts as a negative regulator of p53 stability in different cell types and may provide a negative regulatory loop that limits p53 induction.
17560543 ataxia telangiectasia mutated protein phosphorylation of ZBP-89 contributes to HDACi induction of p21(waf1) gene expression
17556661 a new role for YY1 as both an inducer of p53 instability in smooth muscle cells, and an indirect repressor of p21WAF1/Cip1 transcription, p21WAF1/Cip1-cdk4-cyclin D1 assembly and intimal thickening.
17553787 fibrillar collagen can also arrest cells at the G2 phase, which is mediated in part by p21(CIP1)
17536310 immunoreactivity of p53, MDM2, WAF1, and BCL-2 were measured in soft tissue sarcomas cases consisting of 54 low-grade, 40 intermediate-grade, and 58 high-grade sarcomas
17513615 induction of p21 protects against sulforaphane-induced mitotic arrest in LNCaP cells
17502456 adhesion of mantle cell lymphoma and other non-Hodgkin lymphoma cells to bone marrow stromal cells resulted in a reversible G(1) arrest associated with elevated p27(Kip1) and p21 (WAF1) proteins
17498252 livers maintained effective removal of cells from the cell cycle by overexpression of p21
17477906 reactive oxygen species induce p21(Cip1) degradation through an NES-, Skp2-, and ubiquitin-dependent pathway
17465503 The down-expression of p21(WAF1) mRNA in colorectal carcinoma might be associated with histone hypoacetylation in chromatin but not with biological behaviors.
17460194 stress-induced premature senescence (SIPS) from hydrogen peroxide is associated with a transient increase in DNA-binding activity of p53 and an increased expression of p21(WAF-1) in human hTERT fibroblasts
17460193 CARF may exert a vital control on p53-HDM2-p21(WAF1) pathway that is central to the cell cycle control, senescence, and DNA damage response of human cells
17448597 p21 is upregulated after radical prostatectomy for prostatic neoplasms.
17443496 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17443496 findings do not suggest mutations or polymorphisms of p21B to play a major role with respect to either breast cancer risk or sensitivity towards chemotherapy
17438369 the RUNX2 and YAP65 interaction has a novel role in oncogenic transformation that may be mediated by modulation of p21(CIP1) protein expression
17431791 study demonstrates that PKCdelta-mediated phosphorylation of 146Ser residue of p21WAF1/CIP1 is a novel mechanism for enhancing the cellular stability of the inhibitor protein by blocking caspase-3-mediated degradation
17409409 Observational study of gene-disease association. (HuGE Navigator)
17371838 results argue that Mdm2 is needed for full inhibition of Cdk2 activity by p21, thereby positively contributing to p53-dependent cell cycle arrest
17351341 Observational study of gene-disease association. (HuGE Navigator)
17339230 c-Abl and p53 can be recruited to the region containing p53 binding site of p21 promoter, and c-Abl increases the DNA binding activity of p53 to the p21 promoter
17337084 The expression of p21 in the patients with wild-type EGFR tended to be associated with poor overall survival.
17325029 Binding of p21(Cip1) to apoptosis signal-regulating kinase 1 (ASK1) requires ASK1 kinase function and may involve phosphorylation of S98
17317670 CDA1 induces p53- and MEK/ERK1/2 MAPK-dependent expression of p21 by acting through the p53 responsive element in the p21 promoter and this contributes to its antiproliferative activity
17303651 Multiple lines of evidence indicate that the transcriptional process of p21 is downregulated by depressed zinc status in HepG2 cells.
17300726 p21 plays a key role in mechanisms used by PTEN-deficient tumors to escape chemotherapy
17294043 Spider venom activates the expression of p21 and causes selective cell cycle arrest at G(2)/M phase, leading to HepG2 cell apoptosis.
17293864 Observational study of gene-disease association. (HuGE Navigator)
17292858 p21(WAF1/CIP1) (p21), a negative regulator of the cell division cycle, exhibits proteasome-sensitive turnover and ubiquitination in a tumor cell line.
17286201 PI 3-K signaling pathway suppresses phorbol 12-myristate 13-acetate-induced expression of p21WAF1/Cip1 in human leukemia cells, and that this effect is partly mediated by PKC zeta.
17284535 Loss of p21(WAF1) facilitates AML1-ETO-induced leukemogenesis.
17283049 This is the first demonstration of GSK-3beta as the missing link between UV-induced ATR activation and p21 degradation.
17273559 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
17239344 Has important role in mediating the apoptotic effect of histone deacetylase inhibitors.
17214516 individual variations in radiosensitivity and in the level of induction of TP53 (and consequently CDKN1A) are congruent, irrespective of the genetic background of the nontransformed fibroblasts
17203174 p21 and p27 in carcinoma of oral cavity have roles in progression of squamous cell carcinomas
17188136 p53 and Ki-67 were expressed with increasing frequency, and bcl-2, p21, and mdm-2 with decreasing frequency in thyroid carcinoma progression. p27 and cyclin D1 were expressed in <15% of cases, with a trend toward decreasing expression.
17172832 Vpr may regulate HIV-1 gene expression via interacts with the N- and the C-terminal domains of p21.
17172426 The crucial role of p21Cip/WAF1 in the extracellular signal-regulated kinase pathway-dependent antiproliferative responses by tautomycetin was confirmed by using p21Cip/WAF1 gene-deleted HCT-116 cells.
17158927 While the DNA replication checkpoint is unlikely to regulate the assembly of a p21 promoter initiation complex, it signals to one or more factors involved in the process of transcriptional elongation.
17130157 Identification of a functional target site for the transcription factor, nuclear factor I (NFI), in the basal promoter from the p21 gene.
17109628 association of Zac1 with importin alpha1 is also involved in regulating the transactivation activity of Zac1 on the p21WAF1/CIP1 gene and protein expression
17108107 Chromatin immunoprecipitation analyses show that LKB1 is recruited directly to the p21/WAF1 promoter, as well as to other p53 activated promoters, in a p53-dependent fashion.
17080554 Results suggest that EGCG may have an inhibitory effect on UVB-induced photo-damage and apoptosis by blocking the cytokine secretion and the mRNA expressions of p53, p21 and c-fos genes.
17080297 APMCF1 participates at least partially in cell cycle regulation through regulating genes such as p21 and TIMP3.
17079872 p21 gene promoter in combination with a rAAV vector is potentially usable for the development of a low-dose radiation-inducible vector for cancer gene therapy.
17079232 Dox-induced decrease in KAP1 sumoylation is essential for Dox to induce p21 expression and subsequent cell growth inhibition in MCF-7 cells
17074759 GAX activates p21WAF1/CIP1 expression in vascular endothelial cells through direct interaction with upstream AT-rich sequences
17072949 p27 is widely expressed in gastric well differentiated endocrine tumors (GWDETs), while p21 expression is sparse and observed in two thirds of the cases. Loss of p21 and p27 expressions may be correlated with different carcinoid tumor subtypes.
17062672 Observational study of gene-disease association. (HuGE Navigator)
17062672 association between locally advanced breast cancer and one particular polymorphism of the p21 gene
17059853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17059853 Risk of cancer is markedly increased in heavy smokers (>20 pack-years) with squamous-cell carcinoma carrying an amino acid substitution.
17055654 We find an over-abundance of p21 due to reduced protein turnover, possibly due to the loss of activity of the CSA/CSB E3 ubiquitylation pathway
17054950 The degradation of p21(WAF1/CIP1) induced by PP2Cgamma was mediated in a proteasome-dependent manner.
17050675 RNPC1a is required to maintain the stability of p21 transcript induced by p53.
17016640 This novel finding indicated that IKKbeta could mediate cytoplasmic p21 accumulation via activation of its downstream target Akt, which was known to phosphorylate p21 and lead to cytoplasmic localization of p21.
17014852 Klotho normally regulates cellular senescence by repressing the p53/p21 pathway
17008550 Observational study of gene-disease association. (HuGE Navigator)
16982699 These data show that specific interaction of the Akt2 isoform with p21 is key to its negative effect on normal cell cycle progression.
16953367 p21WAF1/CIP1 and 14-3-3 sigma expression was several fold higher in degenerated aortic valves with no calcification versus degenerated aortic valves with calcification on both transcription and translation levels
16952553 HDACi induction of the cyclin-dependent kinase inhibitor p21(waf1) has been shown to require ataxia-telangiectasia mutated (ATM).
16951143 p53 preferentially occupied the promoters of growth arrest genes p21 and GADD45 in senescent normal human diploid fibroblasts.
16867219 expression of either AP-2gamma or AP-2alpha induces p21 and inhibits breast carcinoma cell growth
16837471 Observational study of gene-disease association. (HuGE Navigator)
16835890 Expression of AR protein in PC3-Lenti-AR cells resulted in transactivation of p21 and growth inhibition in culture and in mouse xenografts. Such inhibition was due to induced G1 arrest as documented by expression changes in p27 and p45(SKP2) proteins.
16831599 EGFR-mediated induction of enterocyte proliferation requires MAPK-dependent increase in p21(waf1/cip1) expression in intestinal epithelial cells.
16818630 P21(waf1/cip1) is identified as a target gene of DDX3, and the up-regulation of p21(waf1/cip1) expression accounted for the colony-suppressing activity of DDX3.
16804901 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16804901 Possible involvement of CDKN1A and CDKN1B variants in the etiology of breast cancer.
16804724 In particular, patients with positive p21/high Ki-67 (P = 0.015) or positive p21/negative cyclin D1 (P = 0.04) showed the worst survival outcome.
16803887 UV induces p21 degradation through an Skp2 and ubiquitin-independent pathway
16777994 analysis of novel mechanisms for apoptosis induction by silibinin involving p53-caspase 2 activation and caspase-mediated cleavage of Cip1/p21
16775840 Loss of a functional mitochondrial electron transport chain inhibits cell-cycle progression, and we postulate that this occurs through the decreased concentration of reactive oxygen species, leading to downregulation of p21CIP1/WAF1.
16765349 suggest a novel retinoic acid (RA)-signaling, by which RA-induced p21 induction and complex formation with cyclin E/cyclin-dependent kinase 2 (CDK2) diverts CDK2 function from normally driving proliferation to alternatively promoting apoptosis
16735508 BRCA1 could act as a CTD kinase inhibitor and, as such, contribute to the regulation of p21 gene expression
16723699 p21-mediated cytoprotection against hyperoxia involves regulation of Bcl-XL and is uncoupled from its ability to inhibit proliferation
16718778 results suggest that inhibition of cell growth by activin is regulated by the negative feedback effect of Smad7 on the activin signaling pathway, and is mediated through p21(CIP1/WAF1) activation in SNU-16 cells
16712793 Pim-1 expression may be regulated by progesterone during mammary development and Pim-1 associates with p21 in mammary epithelial cells
16705171 These data demonstrate a critical role for FAK in the regulation of cyclin-dependent kinase inhibitors (CDKIs) through two independent mechanisms: Skp2 dependent and Skp2 independent.
16678112 In mammalian cells, translesion DNA synthesis (TLS) is controlled by the tumor suppressor p53, and by the cell cycle inhibitor p21 via its PCNA-interacting domain, to maintain a low mutagenic load at the price of reduced repair efficiency.
16616141 low doses of Taxol for 18 h determined the upregulation of p53 and p21 waf expression concomitantly with a decrease of the anti-apoptotic Bcl-2.
16581770 Subcellular targeting of ING1 by phosphorylation-dependent 14-3-3 binding regulates P21 expression.
16580634 LKB1 has the potential to induce p21 expression in collaboration with LMO4, GATA-6, and Ldb1 through the p53-independent mechanism
16554660 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
16551699 These results indicate that early recruitment of p21 protein to DNA-damage sites is a NER-related process dependent on interaction with PCNA, thus suggesting a direct involvement of p21 in DNA repair.
16533812 The role of histone deacetylases in the expression of CDKN1A in normal and neoplastic human colon cells is reported.
16514663 p21(Waf1/Cip1) promoter methylation may be a critical biological barrier to postpone the aging process
16507767 This study demonstrates for the 1st time the involvement of MAPK-cyclin D1-p21(cip)machinery during cell growth inhibition and apoptosis of human vascular smooth muscle cells induced by cysthationine gamma-lyase overexpression.
16480585 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16479163 p50 might target or anchor p21 to pol delta complex upon certain DNA damage such as adriamycin treatment.
16434701 The p21(waf1/cip1) gene is a primary 1alpha,25(OH)2D3-responding gene with at least three VDR binding promoter regions, in two of which also p53 co-localizes.
16432835 p21/WAF1 inactivation may confer a strong resistance to paclitaxel in noncancerous breast epithelial cells harboring a p21/WAF1 mutant.
16394138 MDM2 has critical roles in the regulation of p21 and E2F1 expression, stability and function [review]
16364249 Our results indicate that the TP53 P allele is associated with a worse prognosis (P=0.011) while P21 polymorphism genotypes did not reveal any statistically significant result (P>0.05).
16344056 The signaling pathway for colonocyte apoptosis following toxin A exposure involves p38-dependent activation of p53 and subsequent induction of p21(WAF1/CIP1), resulting in cytochrome c release and caspase-3 activation through Bak induction.
16289646 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16288006 hSNF5 binds the p16INK4a and p21CIP/WAF1 promoters, suggesting that it directly regulates transcription of these genes.
16287849 Gfi1 associates with G9a and HDAC1 on the promoter of the cell cycle regulator p21Cip/WAF1, resulting in an increase in K9 dimethylation at histone H3
16283431 Results describe the opposite effect of ERK1/2 and JNK on p53-independent p21WAF1/CIP1 activation involved in the arsenic trioxide-induced human epidermoid carcinoma A431 cellular cytotoxicity.
16280359 Checkpoint kinase 1 plays a primary role in the protection of cells from death induced by replication fork stress, whereas p21 mediates through its role in regulating entry into S phase
16276353 p21WAF1/CIP1 expression in metastatic prostate cancer cell lines is enhanced as a result of demethylation of the DNA
16262255 Data demonstrate that ubiquitination of p21(Cip1/WAF1) requires a functional interaction between p21(Cip1/WAF1) and the cyclin E-Cdk2 complex.
16256947 Overall, these results suggest that MRPL41 arrests the cell cycle by increasing the p21(WAF1/CIP1) and p27(Kip1) levels under the growth inhibitory conditions.
16254341 Tax1 induced transcriptional upregula inhibitors p21(cip1/waf1) (p21) and p27(kip1) (p27), and marked suppression of hematopoiesis in immature CD34 cells.
16248979 In addition, the transcription factor Sp1 that is involved in the Ras/ERK-mediated control of p21WAF1 regulation in VSMC in response to PDGF has now been identified.
16243918 In summary, the p53/p21 pathway is mainly responsible for GC-induced apoptosis, but the coordinated activation of the p53/p21 and p16 pathway is responsible for GC-induced endothelial cell senescence through a Rb-dependent mechanism.
16214366 musashi homolog 1 ability to regulate progenitor maintenance is through the translational inhibition of the cyclin-dependent kinase inhibitor p21WAF-1.
16200730 Basal expression of p21 plays a more important antiapoptosis role than stress-stimulated p21 in carcinoma cells.
16199872 These data suggest a physiological role of SREBP-1a in p21 regulation.
16191374 The genesis and invasion of ameloblastoma is associated with the cell proliferation and differentiation, and regulated by the higher expression of cyclin E and the lower expression of p21(WAF1) and p27(KIP1).
16182613 p21(CDKN1A) levels after low doses of UV-irradiation may be controlled in a p53-dependent manner without severe reduction.
16150942 KSHV vGPCR expression results in cell-cycle arrest of KSHV-infected PEL cells; it is shown that this arrest is mediated by p21 in a p53-independent manner.
16149052 ERK activation and p21 and N-cadherin upregulation are required for genistein-induced neuronal differentiation
16142340 p21WAF1/CIP1 may have a role in oral tongue squamous cell carcinoma progression
16142303 a change of intracellular distribution of p21CIP1 from nucleus to cytoplasm along with differentiation appears to be anti-apoptotic
16135801 Tumor suppressor activity of RUNX3 is associated with its ability to induce p21 (WAF1/Cip10) expression.
16122475 Overexpression of p21 correlates with chromosomal instability and serves as an adverse prognostic predictor for patients with esophageal squamous cell carcinoma.
16111738 increased mRNA stability is the major mechanism of p21(WAF/CIP1/SDI1) elevation in the hydroxyurea-induced growth arrest of human fibroblasts
16091736 PPARdelta partially rescued prostate epithelial cells from growth inhibition and also dramatically inhibited sulindac sulfide-mediated p21WAF1/CIP1 upregulation.
16082224 p53 codon 72 alleles influence the response to anticancer drugs in cells from aged people by regulating the cell cycle inhibitor p21WAF1
16081043 Sp3 D-domain modulates its protein levels and activation of the p21(CIP1/WAF1) promoter
16080520 P21(WAF1/Cip1) plays a major role in angiogenesis in breast cancer, since tumor cells seem to down-regulate endothelial p21(WAF1/Cip1), compared to endothelial cells grown in serum-free medium.
16078010 Induction of p21WAF1 expression increases tumor cell survival and may result in recurrences at treated sites after cryotherapy.
16054204 p53 and p21 act in series in mediating cell cycle arrest. However, the two risk factors, p53 proline homozygosity and p21 arginine allele, although part of a common causal pathway, appear to act in a mutually exclusive manner.
16014176 p73 upregulates p21 transcript abundance (TA) in BC tissues and upregulated p21 TA may result from E2F1 upregulation of p73 but not from E2F1 directly
16012716 Results suggested that the overexpression of p21(WAF1/CIP1) in conjunction with the loss of p53 expression was a stronger predictor of survival benefit than either molecule alone in Japanese serous-type advanced ovarian cancer.
15975933 p21 is one specific target of PR3; PR3-mediated p21 cleavage prevents monocytic differentiation
15972853 There is enhanced G2/M arrest by NF-kappa B-dependent p21waf1/cip1 induction.
15965232 p300 regulates p63-dependent transcription of p21
15964852 Cdk2 destabilizes p21 via the cy2 cyclin-binding motif and p21 phosphorylation
15960923 Observational study of gene-disease association. (HuGE Navigator)
15944261 This study using lymphocyte proliferation as a model evaluates the effects of recombinant p21 protein on lymphocyte proliferation, cytokine expression, and the mechanism of antiproliferative effects of p21 in activated lymphocytes.
15942645 p21cip1/waf1 has a role in growth, apoptosis and differentiation in human colon carcinoma cells
15936816 The Cyclin-Dependent Kinase Inhibitor p21 plays key roles in cell cycle regulation, and was methylation-negative in myeloid neoplasia.
15905168 mitochondrial stress causes resistance to apoptosis through a p21-dependent pathway
15880942 In cholesteatoma, co-expression of p21 and pERK1/2 was prominent, whereas in retro-auricular skin there was hardly any co-expression.
15880444 physiological concentrations of conjugated linoleic acid inhibit growth of colon cancer cells with either wild-type or mutant p53
15878916 Observational study of gene-disease association. (HuGE Navigator)
15878916 Significant increase in squamous cell carcinoma of the head and neck in the presence of two p21 polymorphisms may be a marker of genetic susceptibility.
15866118 expression of p53, MDM2, and p21Waf1 suggests a role for these oncoproteins in the regulation of endometrioma cell growth, but not in adenomyosis
15840769 the mechanism of p21 protection is by direct inhibition of cdk2 activity and that cisplatin-induced apoptosis in kidney failure is caused by a cdk2-dependent pathway
15839202 Data show a coordinating inhibition of the proliferation of MCF-7 by enhancing expression of p53,p21 and decreasing expression of c-myc
15819981 TP53, CDKN1A, CDKN2A, and CDKN2B have roles in tumorigenesis in skin melanomas, but none of them is a main mutation target for melanoma tumorigenesis
15817070 expression was found to be associated with poorer prognosis and tumor aggressivity in oral squamous cell carcinoma
15807891 This study suggests that the p21 codon 31 polymorphism does not contribute to the risk of POAG (primary open-angle glaucoma) in the Caucasian population.
15798220 Hyperphosphorylated p21 activates the Cdc2 kinase in the G2/M transition.
15776189 unable to arrest tumor progression in oral squamous cell carcinoma
15767448 These data implicate p21 as a pivotal macrophage facilitator of HIV-1 life cycle; regulators of p21, such as CDDO, may provide an interventional approach to modulate HIV-1 replication.
15764647 demonstrated that epigallocatechin-3-gallate activates growth arrest and apoptosis primarily via tumor suppressor p53-dependent pathway that involves the function of both p21 protein and Bax protein
15763542 In the abscence of this this gene in colorectal carcinoma cells, toxicity of histone deacetylase inhibitors was reduced.
15756520 Glioblastoma cells show different and independent responses in their p53 and p21 pathways to ionizing radiation
15753078 galectin-8 is a modulator of cellular growth through up-regulation of p21
15752352 Dehydroepiandrosterone increased the expression of p53 and p21 mRNAs.
15750619 Lack of functional p21 resulted in the accumulation of cells in G2/M phase of the cell cycle and markedly enhanced p14 ARF-induced apoptosis.
15746092 Temporal ectopic expression of p21(Cip1) arrested cell proliferation, inhibited Cdk2 and Cdk4 activities, suppressed retinoblastoma phosphorylation and arrested cells in both G1 and G2 cell cycle phases.
15743834 p21WAF1/CIP1 behaves as a transcriptional coactivator in a gene-specific manner implicated in cell differentiation.
15743033 P21 and Bax have roles in progression of cutaneous malignant melanoma
15738655 pioglitazone generally does not modulate p21 transcription in human cancer cell lines
15736438 Expression of CDKN1A and Gadd45 proteins acting on cell cycle checkpoints and DNA repair in PCa relative to the presence of oxidative DNA damage was measured.
15735102 Quercetin and ellagic acid combined increase the activation of p53 and p21(cip1/waf1.
15716956 Mitf-mediated activation of p21Cip1 expression and consequent hypophosphorylation of Rb1 will contribute to cell cycle exit and activation of the differentiation programme
15709169 Results showed a significant, progressive loss of expression of p21(Cip1/WAF1) with advancing papillary thyroid carcinomas.
15708847 low molecular weight forms of cyclin E may contribute to tumorigenesis through their resistance to the inhibitory activities of p21 and p27 while sequestering these CKIs from the full-length cyclin E
15694838 results suggest that p21 and FasL gene activation is required for myeloid leukemia cell survival or maturation but not for cell death via Sp1 and NFkappaB as regulators of these genes
15694358 Among cyclin-dependent kinase inhibitors, p21 was induced and up-regulated by 15d-PGJ(2), but p16 and p27 were not changed, suggesting that the involvement of p21 in inhibition of cell proliferation.
15690394 p21 is a common target of all TGF-beta superfamily pathways
15671036 the mutually antagonistic action of two RNA-binding proteins, Hu and hnRNP K, control the timing of the switch from proliferation to neuronal differentiation through the post-transcriptional regulation of p21 mRNA
15665816 increased expression leads to increase in apoptosis independent of p53
15665589 p21Cip/WAF1 induction is a determinant in the regulation of colonic proliferation by the ERK pathway.
15664193 Results demonstrate the importance of posttranslational stabilization of p21 protein by WISp39 in regulating cellular p21 activity.
15647383 Rb, p21Cip1, and PCNA have roles in cAMP-mediated inhibition of DNA replication and S phase progression
15645120 differentiation-inducing agents, particularly sodium butyrate, suppress growth of oral squamous carcinoma cells through apoptosis and induce cell differentiation possibly through mechanisms involving COX-2, p27Kip1 and/or p21WAF1/Cip1 in vitro and in vivo
15609309 p21WAF expression is induced by 5-Aza-CdR by demethylation of p73 leading to p53-independent apoptosis in myeloid leukemia
15606307 We conclude that (1) clinically achievable doses of ionizing radiation can trigger CDKN1A-dependent accelerated senescence in some human tumor cell lines that express wild-type TP53.
15598783 Observational study of gene-disease association. (HuGE Navigator)
15592362 The cytoplasmic localization of p21,Cip1 may be the molecular mechanism whereby breast cancer cells circumvent TNF-alpha-induced growth inhibition and apoptosis.
15582998 in tumor cells lacking functional p53 and/or p21, p14(ARF) impaired mitotic entry and enforced a primarily cytoplasmic localization of p34(cdc2) that was associated with a decrease in p34(cdc2) kinase activity and reduced p34(cdc2) protein expression
15555546 Deletion mutants of p21 promoter reveal that sequences between -270 and -264, forming a complex with unidentified nuclear factor(s), were critical for E2A and Snail function. E2A-dependent expression of endogenous p21 gene was also inhibited by Snail.
15528212 c-Myc antagonized the induction of p21Cip1 mediated by oncogenic H-, K-, and N-Ras and by constitutively activated Raf and ERK2
15510615 P21waf1/cip1 system alteration may be an early and frequent event in tongue carcinogenesis.
15509808 IRF-1-p300 interface as an allosteric modifier of DNA-dependent acetylation of p53 at the p21 promoter
15497017 A significant increase in p21, p53, and fas mRNA expression were reported in the proximal incompetent veins; negative correlation between media apoptotic index and p21 mRNA expression was found.
15492264 Nuclear clusterin function is proapoptotic in colon cancer when induced by APC or chemotherapy in the context of p21 expression.
15475071 p21CIP1 mRNA is absent in human T-LBL biopsies and T-ALL cell lines at a high frequency. However, unlike p15INK4B, reduced p21CIP1 expression in T-LBL/ALL is independent of dense promoter-associated CpG methylation
15474507 c-myc downregulation and release from the endogenous p21WAF1/CIP1 promoter contributes to transcriptional activation of the p21WAF1/CIP1 in HeLa cells
15456784 survivin can reduce the cell growth inhibition and apoptosis, and p53 elevates the p21 level, which may attenuate the cell death in the quercetin-treated human lung carcinoma cells
15389598 p21(WAF1), acting through the phosphorylation of pRb, regulates whether 2BS cells cease to proliferate and become senescent but resistant to apoptosis, or whether they accelerate proliferation while becoming more susceptible to apoptotic stimuli
15386430 We conclude that overexpression of PKCdelta in human colon cancer cells induces multiple antineoplastic effects that depend on the activities of p21(Waf1/Cip1) and p53.
15378017 absence of p21 produced no overt alteration of the lifespan of the INK4a/ARF-null mice
15371446 PGA2 stabilizes the p21 mRNA through an ERK-independent increase in cytoplasmic HuR levels and an ERK-dependent association of HuR with the p21 mRNA
15371422 repression of hTERT by endogenous p53 is mediated by p21 and E2F
15367606 Tax1 markedly activated transcription from the cdk inhibitor p21(cip1/waf1) promoter in comparison to Tax2, suggesting that upregulation of p21(cip1/waf1) may account for the differential inhibition of cellular replication kinetics
15347670 Cystathionine gamma-lyase has a role in regulating cell proliferation via a H2S-dependent modulation of ERK1/2 phosphorylation and p21Cip/WAK-1
15342418 P21Cip1 positively regulates the cytotoxic action of thymidylate synthase inhibitors, negatively regulates the cytotoxic action of IFN-gamma, and enhances S-phase exit after thymineless stress in colorectal carcinoma cells.
15340083 Monocytic differentiation of the promyelomonocytic cell lines U937 and HL60 is associated with the upregulation of Brap2 expression concomitantly with the upregulation and cytoplasmic relocalization of p21.
15317660 pdcd4 represses the transcription of the mitosis-promoting factor cyclin-dependent kinase (CDK)1/cdc2 via upregulation of p21(Waf1/Cip1)
15309711 Histone acetylation regulates p21WAF1 expression in human colon cancer cell lines, Colo-320 and SW1116.
15302882 physical interaction of Vpr with Sp1 and p53 could modulate transcriptional activity of p21.
15302882 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
15297421 Cyclin D1, p53, and p21Waf1/Cip1 have roles in progression of serous epithelial ovarian cancer
15291355 Observational study of gene-disease association. (HuGE Navigator)
15286705 Stat3 mediates expression of p21waf1.
15251435 p21WAF1 gene expression is regulated by histone deacetylase inhibitors at the post-transcriptional level in HepG2 cells
15240512 Observational study of gene-disease association. (HuGE Navigator)
15240512 p53 and/or p21(WAF1/CIP1) genotype may influence the progression during gastric tumorigenesis.
15226418 Data show that extracellular signal-regulated kinase 3 (ERK3) is conjugated to ubiquitin via its free NH(2) terminus, and that N-terminal tags stabilize expression of p21 but not that of substrates ubiquitinated on internal lysine residues.
15201979 Relation between expression, DNA ploidy and human papillomavirus infection in cervical carcinoma.
15201954 Disruption of p53-p21/WAF1 cell cycle pathways contributes to tumor progression and worse clinical outcome of hepataocellular hepatoma.
15190207 P21 expression stimulates promoters of six p21-responsive human genes and the cytomegalovirus promoter, as well as an artificial promoter containing NFkappaB response elements.
15184659 hRAD9 and p53 co-regulate p21 to direct cell cycle progression by similar molecular mechanisms.
15184045 Data show that ERK1/2-mediated phosphorylation of hepatitis B viral X-gene (HBx) regulates HBx function and localization, and that HBx repressed transcription from the p21(WAF1/Cip1) promoter.
15181148 in normal cells, p21 exerts a dual role in mediating DNA damage-induced cell cycle arrest and exit before mitosis
15179054 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
15173090 p21Cip1/WAF1 and HER2/neu togehter have a role in progression of breast neoplasms
15171713 Data suggest that dihydrotestosterone reverses titration of p21(Cip1/Waf1) and p27(Kip1) away from Cdk2 complexes, and increased association of p21 with Cdk2 complexes mediates the androgen-induced growth inhibition of breast cancer cells.
15169570 p21/waf1 could potentially function as an assembly factor in HTLV-1 infected cells.
15161699 p21 or p21B do not have a role in causing resistance to doxorubicin or mitomycin/5-fluorouracil in breast cancer
15142382 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
15122333 Low p21 protein levels are caused by reduced p21 gene transcription and sensitize cisplatin-treated TGCT cells to the Fas death pathway
15111320 activation of the p53-p21WAF1 pathway and overexpression of cyclin D1 are induced during tumor cell differentiation by beta-catenin
15107488 hepatitis B virus X protein natural variants have differential effects on p21 expression
15094066 p21(Waf1) can activate the transcription of p16(INK4); this effect is GC-box dependent; and the transcription factor Sp1 plays a key role in this event
15082782 Results suggest that p150(Sal2), acting in part as a p53-independent regulator of p21 and BAX, can function in some cell types as a regulator of cell growth and survival.
15081425 role of pathway in regulating G1-S transition and apoptosis along with RFT
15069711 The expression of p21 protein depends on p53 protein largely in normal gastric mucosa and dysplasia, but not in gastric carcinoma.
15060836 The expression patterns of cyclin D1, cyclin E, p21/waf1 and p27/kip1 in inflammatory bowel disease (IBD) may indicate their contribution in epithelial cell turnover and their possible implication in IBD-related dysplasia-carcinoma.
15059516 In human colon cancer cell lines, HDAC inhibitors stimulate the p21(WAF1) gene expression by selectively increasing the degree of acetylation of the gene-associated histones.
15036662 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15033443 p21WAF1 in vascular smooth muscle cells is regulated by transcription factor Sp1 and p38MAPK
15024057 Results suggest that basic helix-loop-helix proteins provide a direct transcriptional link between a cell cycle inhibitor, p21(Cip1), and a neurotrophic receptor, Trk.
15016552 simultaneous expression of HPV-16 E7 protein and p21 proteins induces apoptosis and activates cathepsin B
15014036 Flavopiridol abrogates depsipeptide mediated induction of p21 expression via inhibition of protein kinase C signaling in malignant pleural mesothelioma cells.
15003515 Transactivation of the CIP1 promotor by fetal liver kinase-3 mutations involves stat5 binding site.
14981901 Loss of p21 and/or p53 might not predict for prognosis in oropharnyggeal squamous cell carcinoma.
14764039 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14762439 TGF-beta-Smad signaling pathway inhibits the growth of human epithelial cells and plays a role in tumor development.
14761977 by reducing p21 protein stability via proteasome-mediated degradation, MDM2 functions as a negative regulator of p21
14759525 Overexpression of integrin beta1 imposed a growth inhibitory effect on a liver neoplastic cell line which is mainly attributed to CIP1.
14751560 Abnormally high amounts of Stat1, Stat5 and p21Cip1 proteins were found in prehypertrophic-hypertrophic chondrocytes, the extent of overexpression being directly related to the severity of the disease
14744793 Perifosine increases Sp1 binding and enhanced p21(waf1/cip1) transcription.
14738489 Observational study of gene-disease association. (HuGE Navigator)
14719078 Assessment of p21, p27, Bax, and cyclin E expression in tumor tissues have been reported to be useful as prognostic factors in head and neck squamous cell carcinoma.
14715257 We present evidence that p21(WAF1) is required for 9-HSA mediated growth arrest in human colon carcinoma cells
14712207 NaB-induced apoptosis required P21(waf1/cip1) and its interaction with PCNA.
14702288 Promoter is hypermethylated in various lymphomas and carcinomas.
14677632 cyclin-dependent kinase inhibitor 1A (p21) levels rise abruptly in individual aging cells and remain elevated for extended periods of time.
14647439 how HO-1 and WAF1/Cip1 were regulated in two gastric cancer cell lines
14642618 in hepatocellular carcinoma, PCNA participates both in DNA synthesis and repair and that highly proliferating cancers may display a sustained DNA-repair.
14637149 We conclude, therefore, that two major components of cell-cell interaction synergistically regulate cell cycle progression in HEK293 cells by regulating p21 expression in a beta-catenin/TCF-dependent manner.
14633995 MDM2 directly inhibits p21waf1/cip1 function by reducing p21waf1/cip1 stability in a ubiquitin-independent fashion
14628083 In adenocarcinomas, no statistically significant correlation was found between K-ras mutational status and p21WAF1/CIP1 and p53 expression.
14607337 Low p21 protein level is associated with advanced TNM stage and positive nodal status of squamous cell carcinoma of hypopharyngeal cancer
14607331 Codon 31 polymorphism in p21 may be associated with the development of esophageal cancer
14597617 p21 down-regulation is multiply determined and is required for the reversibility of the arrest in S phase
14592451 Resveratrol caused a dose-dependent increase in intracellular p53 and p21(WAF1/CIP1) levels.
14580260 Cytoplasmic p21WAFI/CIPI may be a surrogate marker of functional HER-2 in vivo.
14572899 the association of p21 and cyclin A in response to gamma-irradiation requires the CDK2 binding region
14504476 These results suggest that in vivo p21CDKN1A does not interfere with loading of PCNA at DNA replication sites, but prevents, or displaces subsequent binding of DNA polymerase delta to PCNA at the G1/S phase transition.
13678583 UV-induced p21 degradation is essential for optimal DNA repair
12970742 p21 is a transcriptional target of CDX2. Our results may thus provide a new mechanism underlying the functions of CDX2.
12963997 p21WAF1/CIP1, pRB, Bax and NF-kappaB have roles in induction of growth arrest and apoptosis by resveratrol in tumor cell lines
12936910 exposure in vitro to hyperoxia exerts G(1) arrest through p53-dependent induction of p21 that suppresses Cdk and PCNA activity.
12931225 p21 has an antiapoptotic role in monocytic leukemia.
12930846 PARP-1 and p21 could cooperate in regulating the functions of PCNA during DNA replication/repair.
12930830 p21 is required for the G1/S arrest of HCT116 colon cancer cells but its mode of action is more complicated than the simple formation of a physical complex with cyclin-Cdk2
12890637 Hepatitis C virus (HCV) core protein potentially modulates hepatocyte cell cycle differentially in the early stages of infection through biphasic regulation of p21 cdk kinase inhibitor
12885947 High expression of p21 Waf1 is associated with sarcoid granulomas
12884030 The differences in apoptotic activity and p21(WAF1/CIP1) expression between serrated adenomas (SA) and traditional adenomas or hyperplastic polyps indicate that SA should be considered as a distinct subtype of colorectal neoplasm
12867429 p21CIP/WAF is a positive regulator in the cell proliferation induced by IGF-I in MCF-7 cells.
12855666 p21(WAF1) has a role in drug-induced senescence in colorectal cancer cells
12853982 p53RFP, a p53-inducible RING-finger protein, regulates the stability of p21WAF1.
12847090 p21WAF1 binding to HDAC1 is disrupted by Che-1 protein in human colonic carcinoma
12841870 p21 is highly correlated with p73 expression irrespective of the p53 mutation status in human esophageal cancers
12839982 The dysfunction of p21 in NB cells represents a novel mechanism by which the G(0)-G(1) cell cycle checkpoint can be inactivated.
12825853 ErbB positive status was associated with p21 overexpression in human ductal carcinoma in situ.
12810668 The TGF-beta-1-induced decrease in CDK2 kinase activity was the result of increased p21 association with cyclin A-CDK2 and cyclin E-CDK2. , p21 induction in early G(1) is critical for TGF-beta 1 inhibition of CDK2 kinase activity.
12809883 In carcinoma in situ without muscle-invasive disease, positive p21 expression is independently associated with bladder cancer recurrence and progression.
12782595 Histone deacetylase inhibitors activate p21(WAF1) expression via ATM.
12781424 Presence of p53 Pro allele and/or p21 Arg allele is associated with lower downstream target gene expression of p21
12771291 Reduced expression of p21 and p27, being VDR dependent, is major pathogenic factor for nodular parathyroid gland growth in advanced secondary hyperparathyroidism. Review.
12748190 expression of p21/CDKN1A is necessary and sufficient for the negative regulation of gene expression by p53
12727815 Observational study of gene-disease association. (HuGE Navigator)
12727815 CDKN1A and CDKN1B variants are associated with advanced prostate cancer.
12727210 Data show that tetradecanoylphorbol acetate activated p21(WAF-1) expression by a protein kinase c-dependent mechanism and that one specific Sp1 binding site in the p21(WAF-1) promoter was critically essential for this activation.
12716906 laminar flow caused an increase of p21Waf1 level in the wild-type HCT116 (p53+/+) cells but not in the p53-null HCT116 cells
12706118 Mutant p53 can delay growth arrest in senescing fibroblasts without reducing p21(WAF1) expression.
12705898 p21waf1/cip1 is down-regulated in the lymphocytes of rheumatoid arthritis patients.
12699883 Investigations confirmed the rarity of mutations in this gene, arguing against a role for TP21 mutations in skin, head, and neck cancers.
12698196 Inhibitor shows antitumor effect on glioma cells.
12690110 Egr1 controls p21Cip1 expression by directly interacting with a specific sequence on its gene promoter.
12681289 These results suggest that the delay of senescence in cultures grown in the presence of dexamethasone is due to a suppression of the senescence related increase in p21(Waf1/Cip1/Sdi1).
12680256 The growth inhibitory action of ATR is associated with the activation of p21WAF1.
12665584 Abolition of p21(Cip1/Waf1) and p16(Ink4a) functions prevented oncogenically activated Ras from inducing growth arrest and was sufficient for limited anchorage-independent growth but not tumorigenesis.
12665570 deacetylase HDAC1 acts as an antagonist of the tumor suppressor p53 in the regulation of the cyclin-dependent kinase inhibitor p21
12651158 Upon prolonged exposure, progestins activate p53, in human breast and endometrial tumor cells, which up-regulates the p21(Cip1,Waf1) promoter.
12644083 Gene expression is increased in chronic allograft nephropathy and coorelates with the number of acute rejection episodes.
12642873 activation by insulin-like growth factor 1 inhibits UV-induced cell death
12612054 TNFalpha mediates cellular growth arrest through activation of the transcription factor NF-kappaB. The cdk inhibitor p21(Cip1/Waf1) is activated through NF-kappaB and is an important mediator of this growth arrest response
12599217 CDK2 activity was reduced dose-dependently after 24 h of ZD1839 treatment and this effect correlated with increased amount of p27(KIP1) and p21(CIP1/WAF1) associated with CDK2-cyclin-E and CDK2-cyclin-A complexes in head/neck squamous carcinoma cell lines
12573582 HIV-1 Nef upregulates the expression of p21/WAF1 protein in human mesenchymal stem cells
12545156 repression of p21 promoter/reporters as well as the endogenous p21 gene by Myc depends on interaction with Miz-1. Expression of Miz-1 increases during hematopoietic differentiation and Miz-1 activates the p21 promoter under conditions of low Myc levels
12531694 Downregulation of waf1 mediates apoptosis of human hepatocellular carcinoma cells in response to interferon-gamma.
12527941 p21 expression correlates positively with proliferation in oral squamous cell carcinoma. Up-regulation of p21 is associated with early progression.
12519780 p21 expression is regulated via a mechanism that is suppressed by PP5
12517948 A direct role is demonstrated for p21 in suppressing spontaneous IL-6 and MMP-1 production in rheumatoid arthritis synovial fibroblasts, whereas p21 overexpression has no effect on IL-6 or MMP-1 production in normal and osteoarthritic synovium.
12513833 p21(WAF1) transfection decreases sensitivity of K562 cells to VP-16
12485998 WAF1 degradation is regulated by atypical PKC and PDK1
12474524 Observational study of gene-disease association. (HuGE Navigator)
12474524 Codon 31 polymorphism is associated with bladder cancer
12459877 p21(waf1) has a role in aortal endothelial cell aging
12457968 Hepatitis C virus NS4A and NS4B proteins at inhibited p21/Waf1 expression post-transcriptionally
12441075 LMP1 inhibits transforming growth factor-beta 1-mediated induction of MAPK/p21 in Epstein-barr virus infected gastric epithelial cell line GT38
12434183 cyclin kinase inhibitors p21 are associated with laryngeal papillomas.
12431987 The 3'-untranslated region of this protein's mRNA is a composite cis-acting sequence bound by RNA-binding proteins from breast cancer cells, including HuR and poly(C)-binding protein.
12429910 promoter elements responsible for transcriptional inhibition of polo-like kinase 1 and topoisomerase IIalpha genes by p21(WAF1/CIP1/SDI1)
12412576 Lack of p21(CIP1) DNA methylation was found in 31 patients with acute lymphocytic leukemia.
12400017 Observational study of gene-disease association. (HuGE Navigator)
12400017 In conclusion, no polymorphism exists in codon 149 of P21(Waf1/Cip1).
12396717 Oxidative stress induces rapid, but reversible, downregulation of functional p21 by accelerating its protein turnover.
12393707 Forced expression of STAT5a in human cord blood-derived CD34+ cells enhanced expression Bcl-2 and p21(WAF/Cip1), suggesting they may be important in STAT5a-mediated eosinophil differentiation.
12392301 insulin inhibits TNF-alpha-dependent cell killing, induction of p53, p21 and apoptosis in a human cervical carcinoma cell line
12388558 role of PIN1 in transactivation
12384701 By inhibiting p21(Cip1) expression Myc favours the initiation of apoptosis, thereby influencing the outcome of a p53 response in favour of cell death
12379120 The proximal p21(WAF-1/Cip1) promoter region has been characterized and the contribution of individual Sp1 binding sites to both constitutive and inducible promoter activity in hepatocytes is analyzed in detail.
12370305 p21(cip1) induction is interrupted by ROCK-mediated signal transduction in preapoptotic cells
12359245 relationship of Mcl-1 isoforms, ratio to cyclin A and Jun kinase phosphorylation to apoptosis in human breast carcinomas
12354776 Cleavage of p21waf1 by proteinase-3, a myeloid-specific serine protease, potentiates cell proliferation
12205674 Msx2 and p21(CIP1/WAF1) mediate the proapoptotic effects of bone morphogenetic protein-4 on ventricular zone progenitor cells.
12204872 p21(CIP1/WAF1) protein expression was increased in AMs and biopsies isolated from smokers and was found predominantly within the cytoplasm.
12168821 Mutations of the cell cycle arrest gene p21WAF1, but not the metastasis-inducing gene S100A4, are frequent in oral squamous cell carcinomas from Sudanese toombak dippers and non-snuff-dippers from the Sudan, Scandinavia, USA and UK.
12151395 inactivation sensitizes cells to apoptosis via an increase of both p14ARF and p53 levels and an alteration of the Bax/Bcl-2 ratio
12151347 Sp1-mediated activation of p21(WAF1/CIP1) expression is accompanied by G(1) cell cycle arrest induced by 3,3'-diindolylmethane in human breast cancer cells
12151346 role in modulating threshold of apoptosis induced by DNA-damage and growth factor withdrawal in prostate cancer cells
12145325 C/EBPalpha is essential for p21-mediated inhibition of G1 to S-phase progression by RAP in KSHV-infected host cells
12138103 transcriptional regulation of p21 CIP1 WAF1 controls p53 independent ovarian cancer apoptosis
12123335 P27Kip1 immunoreactivity is higher in male breast cancers compared with female breast cancers.
12111504 p21/WAF1 expression associated with endocrine activity in pituitary adenomas; tumors expressing cytoplasmic p21/WAF1 may have resistance to DNA-damaging agents such as ionizing radiation
12058028 stabilization by phosphorylation influenzed by protein kinase p38 alpha and JNK1
12055678 results suggested that p21 is up-regulated by the stress of inflammation and fibrosis in hepatitis C virus (HCV)-associated chronic liver diseases and that high p21 expression might be related to hepatocarcinogenesis in cirrhotic patients
12054658 Oxidized low density lipoprotein induces the cyclin-dependent kinase inhibitor p21(waf1) and the tumor suppressor Rb.
12054572 Identification of the regulatory region required for ubiquitination of the cyclin kinase inhibitor, p21.
12054510 H(2)O(2)-induced AP-1 activation and its effect on p21(WAF1/CIP1)-mediated G2/M arrest in a p53-deficient human lung cancer cell.
12052868 Cell attachment to the extracellular matrix induces proteasomal degradation of p21(CIP1) via Cdc42/Rac1 signaling (P21CIP1)
12046058 Review of the influence of histone acetylation and DNA methylation on p21(WAF1) transcription, and affection of pathways or factors associated such as p 53, E2A, Sp1 as well as several histone deacetylation inhibitors.
12025230 interferon-alpha exerts antitumor effects by increased p21 expression in neuroendocrine tumors
12015083 A strong inhibition of cell proliferation was observed in K562-p21(WAF1) cell as compared with that of the control, and the cell number in G(0)/G(1) phase was remarkably increased.
11989975 Results suggest that p21(Cip/WAF1) and cyclin D1 induction may result from the activation of the ERK and PI-3 kinase pathways.
11968052 Correlation of p21 gene codon 31 polymorphism and TNF-alpha gene polymorphism with nasopharyngeal carcinoma.
11956602 expression in pelvic lymph nodes and primary tumors in early stage cervical carcinomas
11953864 cyclooxygenase-2 inhibitor induces G0/G1 cell cycle arrest in NA cells by upregulation of p21
11943869 Negative regulation of cell growth and differentiation by TSG101 through association with p21(Cip1/WAF1).
11911463 Expression of p21WAF1 is dependent on the activation of ERK during vitamin E-succinate-induced monocytic differentiation.
11908736 REVIEW: gene expression regulation and role of CDK inhibitor P21 in cell survival and cell cycle control in early hematopoiesis.
11893252 Early induction of CDKN1A (p21) and GADD45 mRNA by a low dose of ionizing radiation is due to their dose-dependent post-transcriptional regulation
11882322 Specific inhibition of p21(Waf1/Cip1) protein with the antisense oligodeoxynucleotide markedly reduces the production and secretion of the matrix proteins fibronectin and laminin, both in the presence and absence of TGF-beta stimulation.
11877436 Role of p21 in apoptosis and senescence of human colon cancer cells treated with camptothecin
11877298 The onset of ATRA-induced G(0)/G(1) arrest of U-937 cells is linked to an increase in p21(WAF1/CIP1) expression.
11877274 Inhibition of bone marrow stem cell proliferation by retinol was mediated by the up-regulation of cyclin-dependent kinase inhibitors, p21(Cip1) and p27(Kip1).
11872638 Observational study of gene-disease association. (HuGE Navigator)
11872638 We investigated three common sequence variants in TP53 and p21 for possible associations with the risk of breast cancer and with various phenotypic features of this disease
11860939 The expression of p21(WAF1/CIP1) was higher in the skin of arsenic intoxication than in controls.
11842244 hinge region of the human papillomavirus type 8 E2 protein activates the human p21(WAF1/CIP1) promoter via interaction with Sp1
11815410 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11809712 Loss of the p21(Cip1/Waf1) cyclin kinase inhibitor results in propagation of horizontally transferred DNA.
11781193 expression in normal, hyperplastic and carcinomatous human prostate
11762751 expression inhibited by Hepatitis C virus core protein
11756412 phosphorylation by AKT/PKB enhances protein stability and promotes cell survival
11751903 The ability of p21(Cip1) to inhibit cyclin D1 nuclear export correlates with its ability to bind to Thr-286-phosphorylated cyclin D1 and thereby prevents cyclin D1.CRM1 association
11751405 Overexpression of p21(WAF1/CIP1) is an early event in the development of pancreatic intraepithelial neoplasia.
11748297 induced after DNA damage and plays a role in cell survival
11741909 Cdk4 activity does correlate with changes in the level of the Cdk inhibitor p21(WAF1/Cip1
11733969 In the ovarian cancer cell lines studied, cell growth was inhibited after transfection with p16(INK4a), p21(WAF1/Cip-1), and p53.
11700040 tested for inhibition of Plasmodium falciparum cyclin dependent protein kinases
11695244 p21CIP1/WAF1 was able to repress the immortal phenotype. CDKIs mediate growth arrest in human osteosarcoma cell lines and provides further evidence of the existence of molecular links between cellular mortality and immortality.
11642719 expression is related to apoptosis in thymus
11179504 Observational study of gene-disease association. (HuGE Navigator)
11084299 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRG      1 - 70
LGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGR     71 - 140
KRRQTSMTDFYHSKRRLIFSKRKP                                                  141 - 164
//

Text Mined References (1265)

PMID Year Title
27156331 2016 SNP rs1059234 in CDKN1A Gene Correlates with Prognosis in Resected Gastric Adenocarcinoma.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27012093 2015 [RELATIONSHIP BETWEEN p53/p21/Rb AND MAPK SIGNALING PATHWAYS IN HUMAN ENDOMETRIUM-DERIVED STEM CELLS UNDER OXIDATIVE STRESS].
26986513 2016 NORE1A induction by membrane-bound CD40L (mCD40L) contributes to CD40L-induced cell death and G1 growth arrest in p21-mediated mechanism.
26970274 2016 Prolactin inhibits a major tumor-suppressive function of wild type BRCA1.
26940882 2016 Estrogen-related receptor ? is upregulated in liver cancer and its inhibition suppresses liver cancer cell proliferation via induction of p21 and p27.
26876176 2016 Dynamics of CDKN1A in Single Cells Defined by an Endogenous Fluorescent Tagging Toolkit.
26861625 2016 Foxo3 circular RNA retards cell cycle progression via forming ternary complexes with p21 and CDK2.
26832959 2016 Stabilization of p21 by mTORC1/4E-BP1 predicts clinical outcome of head and neck cancers.
26823785 2015 Expression of CDKN1A/p21 and TGFBR2 in breast cancer and their prognostic significance.
26754670 2016 Radiation-induced miR-208a increases the proliferation and radioresistance by targeting p21 in human lung cancer cells.
26740620 2016 High-throughput Functional Genomics Identifies Regulators of Primary Human Beta Cell Proliferation.
26730949 2016 p21CDKN1A Regulates the Binding of Poly(ADP-Ribose) Polymerase-1 to DNA Repair Intermediates.
26713361 2016 Evodiamine selectively targets cancer stem-like cells through the p53-p21-Rb pathway.
26687534 2016 P21(Waf1/Cip1) plays a critical role in furazolidone-induced apoptosis in HepG2 cells through influencing the caspase-3 activation and ROS generation.
26677902 2015 Induction of cell cycle arrest via the p21, p27-cyclin E,A/Cdk2 pathway in SMMC-7721 hepatoma cells by clioquinol.
26659654 2016 Hippocalcin-like 1 suppresses hepatocellular carcinoma progression by promoting p21(Waf/Cip1) stabilization by activating the ERK1/2-MAPK pathway.
26648284 2016 MiR-512-5p induces apoptosis and inhibits glycolysis by targeting p21 in non-small cell lung cancer cells.
26600172 2015 The Roles of p21(Waf1/CIP1) and Hus1 in Generation and Transmission of Damage Signals Stimulated by Low-Dose Alpha-Particle Irradiation.
26595675 2015 Indirect p53-dependent transcriptional repression of Survivin, CDC25C, and PLK1 genes requires the cyclin-dependent kinase inhibitor p21/CDKN1A and CDE/CHR promoter sites binding the DREAM complex.
26572940 2016 Histone deacetylase 4 increases progressive epithelial ovarian cancer cells via repression of p21 on fibrillar collagen matrices.
26546411 2015 p21 deficiency is susceptible to osteoarthritis through STAT3 phosphorylation.
26506264 2015 p21(WAF1) modulates drug-induced apoptosis and cell cycle arrest in B-cell precursor acute lymphoblastic leukemia.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26486079 2015 CGK733-induced LC3 II formation is positively associated with the expression of cyclin-dependent kinase inhibitor p21Waf1/Cip1 through modulation of the AMPK and PERK/CHOP signaling pathways.
26436589 2015 PRMT6 increases cytoplasmic localization of p21CDKN1A in cancer cells through arginine methylation and makes more resistant to cytotoxic agents.
26402653 2015 MiR-423-3p enhances cell growth through inhibition of p21Cip1/Waf1 in colorectal cancer.
26400164 2016 LRH-1 drives colon cancer cell growth by repressing the expression of the CDKN1A gene in a p53-dependent manner.
26384650 2015 Leucine-Rich Repeat Kinase 2 (LRRK2) phosphorylates p53 and induces p21(WAF1/CIP1) expression.
26384566 2016 The p53-p21-DREAM-CDE/CHR pathway regulates G2/M cell cycle genes.
26384350 2015 Long noncoding RNA HOXA-AS2 promotes gastric cancer proliferation by epigenetically silencing P21/PLK3/DDIT3 expression.
26352014 2015 Polo?like kinase 3 inhibits osteosarcoma cell proliferation and tumorigenesis via cooperative interaction with p21.
26340092 2015 Negative Regulation of p21Waf1/Cip1 by Human INO80 Chromatin Remodeling Complex Is Implicated in Cell Cycle Phase G2/M Arrest and Abnormal Chromosome Stability.
26335183 2015 Differential targeting of the cyclin-dependent kinase inhibitor, p21CIP1/WAF1, by chelators with anti-proliferative activity in a range of tumor cell-types.
26289323 2015 Association of p53 rs1042522, MDM2 rs2279744, and p21 rs1801270 polymorphisms with retinoblastoma risk and invasion in a Chinese population.
26278624 2015 Association of p21 3' UTR gene polymorphism with cancer risk: Evidence from a meta-analysis.
26238857 2015 MiR-106b induces cell radioresistance via the PTEN/PI3K/AKT pathways and p21 in colorectal cancer.
26231799 2015 miR-4295 promotes cell proliferation and invasion in anaplastic thyroid carcinoma via CDKN1A.
26223645 2015 Antagonistic Relationship between Human Cytomegalovirus pUL27 and pUL97 Activities during Infection.
26217035 2015 c-Abl-mediated tyrosine phosphorylation of JunB is required for Adriamycin-induced expression of p21.
26212257 2015 Resveratrol and curcumin synergistically induces apoptosis in cigarette smoke condensate transformed breast epithelial cells through a p21(Waf1/Cip1) mediated inhibition of Hh-Gli signaling.
26203195 2015 Nucleolar GTP-binding Protein-1 (NGP-1) Promotes G1 to S Phase Transition by Activating Cyclin-dependent Kinase Inhibitor p21 Cip1/Waf1.
26199387 2015 Cellular Senescence Markers p16INK4a and p21CIP1/WAF Are Predictors of Hodgkin Lymphoma Outcome.
26191193 2015 Clinicopathologic and prognostic significance of p21 (Cip1/Waf1) expression in bladder cancer.
26187313 2015 Distinct roles of transforming growth factor-? signaling and transforming growth factor-? receptor inhibitor SB431542 in the regulation of p21 expression.
26177745 2015 Concentration-dependent differential effects of an epothilone analog on cell cycle and p53 signaling.
26171916 2015 Combined Immunohistochemistry of PLK1, p21, and p53 for Predicting TP53 Status: An Independent Prognostic Factor of Breast Cancer.
26151768 2015 Roscovitine has anti-proliferative and pro-apoptotic effects on glioblastoma cell lines: A pilot study.
26149128 2016 Neisseria meningitidis causes cell cycle arrest of human brain microvascular endothelial cells at S phase via p21 and cyclin G2.
26102367 2015 Translational Upregulation of an Individual p21Cip1 Transcript Variant by GCN2 Regulates Cell Proliferation and Survival under Nutrient Stress.
26067234 2015 MAF1 represses CDKN1A through a Pol III-dependent mechanism.
26053095 2015 PP2A inhibitors arrest G2/M transition through JNK/Sp1- dependent down-regulation of CDK1 and autophagy-dependent up-regulation of p21.
26036262 2015 SOX9, a potential tumor suppressor in cervical cancer, transactivates p21WAF1/CIP1 and suppresses cervical tumor growth.
26032092 2015 Curcumin inhibits growth of prostate carcinoma via miR-208-mediated CDKN1A activation.
26028110 2015 Quantitative Assessment the Relationship between p21 rs1059234 Polymorphism and Cancer Risk.
26025442 2015 Identification of markers that functionally define a quiescent multiple myeloma cell sub-population surviving bortezomib treatment.
26019036 DNA methylation markers and serum ?-fetoprotein level are prognostic factors in hepatocellular carcinoma.
26012475 2015 The Effects of miR-20a on p21: Two Mechanisms Blocking Growth Arrest in TGF-?-Responsive Colon Carcinoma.
26006237 2015 Spontaneous ?H2AX Foci in Human Solid Tumor-Derived Cell Lines in Relation to p21WAF1 and WIP1 Expression.
26002196 2015 The identification of translesion DNA synthesis regulators: Inhibitors in the spotlight.
25990325 2015 FOXO target gene CTDSP2 regulates cell cycle progression through Ras and p21(Cip1/Waf1).
25987237 2015 Increased levels of p21((CIP1/WAF1)) correlate with decreased chondrogenic differentiation potential in synovial membrane progenitor cells.
25972089 2015 p21 Exploits Residue Tyr151 as a Tether for High-Affinity PCNA Binding.
25959498 2015 lncRNA GAS5 enhances G1 cell cycle arrest via binding to YBX1 to regulate p21 expression in stomach cancer.
25928067 2015 Downregulated Long Noncoding RNA BANCR Promotes the Proliferation of Colorectal Cancer Cells via Downregualtion of p21 Expression.
25925725 2015 The Role of p21 in Apoptosis, Proliferation, Cell Cycle Arrest, and Antioxidant Activity in UVB-Irradiated Human HaCaT Keratinocytes.
25918708 2015 A New Double Stranded RNA Suppresses Bladder Cancer Development by Upregulating p21 (Waf1/CIP1) Expression.
25912549 2015 Low inducible expression of p21Cip1 confers resistance to paclitaxel in BRAF mutant melanoma cells with acquired resistance to BRAF inhibitor.
25896246 2015 Barrier Function of the Repaired Skin Is Disrupted Following Arrest of Dicer in Keratinocytes.
25893733 2015 MicroRNA-221/222 regulate ox-LDL-induced endothelial apoptosis via Ets-1/p21 inhibition.
25885043 2015 The leukemia inhibitory factor (LIF) and p21 mediate the TGF? tumor suppressive effects in human cutaneous melanoma.
25835715 2015 Expression of p53, p21(CIP1/WAF1) and eIF4E in the adjacent tissues of oral squamous cell carcinoma: establishing the molecular boundary and a cancer progression model.
25799222 2015 Association between GWAS-identified genetic variations and disease prognosis for patients with colorectal cancer.
25788262 2015 Caffeic acid phenethyl ester induced cell cycle arrest and growth inhibition in androgen-independent prostate cancer cells via regulation of Skp2, p53, p21Cip1 and p27Kip1.
25773855 2015 Silibilin-induces apoptosis in breast cancer cells by modulating p53, p21, Bak and Bcl-XL pathways.
25746435 2015 p21(WAF1/CIP1) RNA expression in highly HIV-1 exposed, uninfected individuals.
25733682 2015 The control operated by the cell cycle machinery on MEF2 stability contributes to the downregulation of CDKN1A and entry into S phase.
25710583 2016 The Differential Immunohistochemical Expression of p53, c-Jun, c-Myc, and p21 Between HCV-related Hepatocellular Carcinoma With and Without Cirrhosis.
25699361 Knockdown of nucleostemin can inhibit the proliferation of esophageal carcinoma cells in vitro through upregulating p21.
25695884 2015 MicroRNA-93 promotes ovarian granulosa cells proliferation through targeting CDKN1A in polycystic ovarian syndrome.
25695279 2015 Expression and mutational analysis of Cip/Kip family in early glottic cancer.
25681685 2015 The hypoxia-induced microRNA-130a controls pulmonary smooth muscle cell proliferation by directly targeting CDKN1A.
25675191 2015 Dysregulation of CDK inhibitors and p53 in HPV-negative endocervical adenocarcinoma.
25674264 2014 Increased expression of oncogene-induced senescence markers during cervical squamous cell cancer development.
25663530 2016 ?-catenin regulates c-Myc and CDKN1A expression in breast cancer cells.
25635878 2015 INMAP overexpression inhibits cell proliferation, induces genomic instability and functions through p53/p21 pathways.
25633810 2015 MicroRNA-93 activates c-Met/PI3K/Akt pathway activity in hepatocellular carcinoma by directly inhibiting PTEN and CDKN1A.
25625488 2015 The effects of two polymorphisms on p21cip1 function and their association with Alzheimer's disease in a population of European descent.
25616665 2015 MicroRNA-520g confers drug resistance by regulating p21 expression in colorectal cancer.
25578966 2015 DICER-dependent biogenesis of let-7 miRNAs affects human cell response to DNA damage via targeting p21/p27.
25557355 2015 Orphan nuclear receptor TLX functions as a potent suppressor of oncogene-induced senescence in prostate cancer via its transcriptional co-regulation of the CDKN1A (p21(WAF1) (/) (CIP1) ) and SIRT1 genes.
25547435 2015 HOTAIR enhanced aggressive biological behaviors and induced radio-resistance via inhibiting p21 in cervical cancer.
25544776 2015 The anti-leukemic activity of sodium dichloroacetate in p53mutated/null cells is mediated by a p53-independent ILF3/p21 pathway.
25532599 2015 p21, p53, TP53BP1 and p73 polymorphisms and the risk of gastric cardia adenocarcinoma in a Chinese population.
25524938 2015 p21{Waf1/CIP1} is a poor diagnostic and prognostic marker for OSCC although its expression increases in patients with N1 regional metastasis.
25521075 2015 Synergistic anti-tumour effects of tetrandrine and chloroquine combination therapy in human cancer: a potential antagonistic role for p21.
25510663 2015 MicroRNA-17 promotes normal ovarian cancer cells to cancer stem cells development via suppression of the LKB1-p53-p21/WAF1 pathway.
25504755 2015 Long noncoding RNA ANRIL promotes non-small cell lung cancer cell proliferation and inhibits apoptosis by silencing KLF2 and P21 expression.
25486478 2014 Bimodal regulation of p21(waf1) protein as function of DNA damage levels.
25483783 2015 ANKHD1 represses p21 (WAF1/CIP1) promoter and promotes multiple myeloma cell growth.
25483104 2015 Loss of p21Cip1/CDKN1A renders cancer cells susceptible to Polo-like kinase 1 inhibition.
25474241 2014 Loss of compensatory pro-survival and anti-apoptotic modulator, IKK?, sensitizes ovarian cancer cells to CHEK1 loss through an increased level of p21.
25460500 2014 Cooperation between BRCA1 and vitamin D is critical for histone acetylation of the p21waf1 promoter and growth inhibition of breast cancer cells and cancer stem-like cells.
25450384 2014 Overexpressed KDM5B is associated with the progression of glioma and promotes glioma cell growth via downregulating p21.
25447520 2014 Up-regulation of p21(WAF1/CIP1) by miRNAs and its implications in bladder cancer cells.
25435372 2015 LRH-1 controls proliferation in breast tumor cells by regulating CDKN1A gene expression.
25421815 2014 Overexpression p21WAF1/CIP1 in suppressing retinal pigment epithelial cells and progression of proliferative vitreoretinopathy via inhibition CDK2 and cyclin E.
25416956 2014 A proteome-scale map of the human interactome network.
25412309 2014 PKC? promotes senescence induced by oxidative stress and chemotherapy.
25394506 2015 Downregulation of Msi1 suppresses the growth of human colon cancer by targeting p21cip1.
25384499 2015 Chidamide, a histone deacetylase inhibitor, functions as a tumor inhibitor by modulating the ratio of Bax/Bcl-2 and P21 in pancreatic cancer.
25371069 2015 Activating transcription factor 3 interferes with p21 activation in histone deacetylase inhibitor-induced growth inhibition of epidermoid carcinoma cells.
25361006 2014 Down-regulation of miRNA-106b inhibits growth of melanoma cells by promoting G1-phase cell cycle arrest and reactivation of p21/WAF1/Cip1 protein.
25349305 2015 Combined CDKN1A/TP53 mutation in bladder cancer is a therapeutic target.
25333671 2014 Association of p53/p21 expression and cigarette smoking with tumor progression and poor prognosis in non-small cell lung cancer patients.
25329316 2014 A mouse model uncovers LKB1 as an UVB-induced DNA damage sensor mediating CDKN1A (p21WAF1/CIP1) degradation.
25304329 2015 Increased effectiveness of carbon ions in the production of reactive oxygen species in normal human fibroblasts.
25295585 2014 Endoplasmic reticulum stress sensitizes cells to DNA damage-induced apoptosis through p53-dependent suppression of p21(CDKN1A).
25288747 2014 KAISO, a critical regulator of p53-mediated transcription of CDKN1A and apoptotic genes.
25281925 2014 The expression of p21 is upregulated by forkhead box A1/2 in p53-null H1299 cells.
25275486 2014 Epstein-Barr virus nuclear antigen 3A promotes cellular proliferation by repression of the cyclin-dependent kinase inhibitor p21WAF1/CIP1.
25267623 2014 Basal p21 controls population heterogeneity in cycling and quiescent cell cycle states.
25267570 2014 BAX and CDKN1A polymorphisms correlated with clinical outcomes of gastric cancer patients treated with postoperative chemotherapy.
25263704 2014 Osteoclastogenic activity of translationally-controlled tumor protein (TCTP) with reciprocal repression of p21.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25236744 2014 Human OXR1 maintains mitochondrial DNA integrity and counteracts hydrogen peroxide-induced oxidative stress by regulating antioxidant pathways involving p21.
25227106 2014 Effects of downregulation of SIRT3 expression on proliferation and apoptosis in esophageal squamous cell carcinoma EC9706 cells and its molecular mechanisms.
25203321 2014 A functional genomic approach identifies FAL1 as an oncogenic long noncoding RNA that associates with BMI1 and represses p21 expression in cancer.
25155625 2014 Combination of SAHA and bortezomib up-regulates CDKN2A and CDKN1A and induces apoptosis of Epstein-Barr virus-positive Wp-restricted Burkitt lymphoma and lymphoblastoid cell lines.
25151143 2015 No association between p21 gene rs1059234 polymorphisms and risk of endometrial cancer among Han women in Northeast China.
25141863 2014 Cooperative actions of p21WAF1 and p53 induce Slug protein degradation and suppress cell invasion.
25131797 2015 p21/Cyclin E pathway modulates anticlastogenic function of Bmi-1 in cancer cells.
25121590 2014 EBNA3C augments Pim-1 mediated phosphorylation and degradation of p21 to promote B-cell proliferation.
25120812 2014 Over-expression of p53, p21 and Cdc2 in histologically negative surgical margins is correlated with local recurrence of laryngeal squamous cell carcinoma.
25088197 2015 Regulation of p21 by TWIST2 contributes to its tumor-suppressor function in human acute myeloid leukemia.
25058453 2014 Altered expression of p21, activated caspase-3, and PCNA in bronchiolar epithelium of smokers with and without chronic obstructive pulmonary disease.
25051367 2014 Overexpression of HMGB1 in melanoma predicts patient survival and suppression of HMGB1 induces cell cycle arrest and senescence in association with p21 (Waf1/Cip1) up-regulation via a p53-independent, Sp1-dependent pathway.
25035420 2014 Identification of three novel genetic variations associated with electrocardiographic traits (QRS duration and PR interval) in East Asians.
25024194 2014 Synergistic tumor suppression by combined inhibition of telomerase and CDKN1A.
24993775 2014 Long non-coding RNA urothelial carcinoma associated 1 induces cell replication by inhibiting BRG1 in 5637 cells.