Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent (275)

Expression

Gene RIF (1)

AA Sequence

MEKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALREIRMLKQLKHPNLVNLIEVF      1 - 70
RRKRKMHLVFEYCDHTLLNELERNPNGVADGVIKSVLWQTLQALNFCHIHNCIHRDIKPENILITKQGII     71 - 140
KICDFGFAQILIPGDAYTDYVATRWYRAPELLVGDTQYGSSVDIWAIGCVFAELLTGQPLWPGKSDVDQL    141 - 210
YLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQL    211 - 280
LESSYFDSFQEAQIKRKARNEGRNRRRQQQAPKSAFPRLFLKTKICQVQRNETQTSGNQILPNGPILQNS    281 - 350
MVTVMTNINSAVYQVTVLHLLSENFEVKS                                             351 - 379
//

Text Mined References (4)

PMID Year Title