Property Summary

Ligand Count 1
NCBI Gene PubMed Count 10
PubMed Score 4.98
PubTator Score 6.19

Knowledge Summary

Patent (2,118)

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 5.2e-09
osteosarcoma 7950 2.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Meckel syndrome 46 3.516 1.8
Joubert syndrome 66 3.173 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.077 2.8e-04
ovarian cancer 1.500 5.2e-09

Gene RIF (4)

AA Sequence

MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAMREIKFLKQFHHENLVNLIEVFR      1 - 70
QKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITK     71 - 140
LCDFGFARTLAAPGDIYTDYVATRWYRAPELVLKDTSYGKPVDIWALGCMIIEMATGNPYLPSSSDLDLL    141 - 210
HKIVLKVGNLSPHLQNIFSKSPIFAGVVLPQVQHPKNARKKYPKLNGLLADIVHACLQIDPADRISSSDL    211 - 280
LHHEYFTRDGFIEKFMPELKAKLLQEAKVNSLIKPKESSKENELRKDERKTVYTNTLLSSSVLGKEIEKE    281 - 350
KKPKEIKVRVIKVKGGRGDISEPKKKEYEGGLGQQDANENVHPMSPDTKLVTIEPPNPINPSTNCNGLKE    351 - 420
NPHCGGSVTMPPINLTNSNLMAANLSSNLFHPSVRLTERAKKRRTSSQSIGQVMPNSRQEDPGPIQSQME    421 - 490
KGIFNERTGHSDQMANENKRKLNFSRSDRKEFHFPELPVTIQSKDTKGMEVKQIKMLKRESKKTESSKIP    491 - 560
TLLNVDQNQEKQEGGDGHCEGKNLKRNRFFFW                                          561 - 592
//

Text Mined References (11)

PMID Year Title