Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.48
PubTator Score 103.92

Knowledge Summary

Patent (17,200)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 3.9e-32
ovarian cancer 8491 5.3e-09
lung carcinoma 2844 1.7e-08
lung cancer 4473 1.0e-04
Disease Target Count Z-score Confidence
Meckel syndrome 48 3.524 1.8
Joubert syndrome 62 3.205 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer -1.900 1.0e-04
lung carcinoma -1.100 1.7e-08
ovarian cancer 1.300 5.3e-09
psoriasis -2.300 3.9e-32

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (2)

PMID Text
25333262 High CDKL2 promotes epithelial-mesenchymal transition and breast cancer progression.
16631599 We hypothesized that LA might induce dissociation of p56(Lck) from CD4, thus leading to its downmodulation.

AA Sequence

MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNLLEVC      1 - 70
KKKKRWYLVFEFVDHTILDDLELFPNGLDYQVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVV     71 - 140
KLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDVWAIGCLVTEMFMGEPLFPGDSDIDQ    141 - 210
LYHIMMCLGNLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAE    211 - 280
LLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPKIKD    281 - 350
YKLFKIKGSKIDGEKAEKGNRASNASCLHDSRTSHNKIVPSTSLKDCSNVSVDHTRNPSVAIPPLTHNLS    351 - 420
AVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQME    421 - 490
HQH                                                                       491 - 493
//

Text Mined References (13)

PMID Year Title
25333262 2014 CDKL2 promotes epithelial-mesenchymal transition and breast cancer progression.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16631599 2006 Lipoic acid downmodulates CD4 from human T lymphocytes by dissociation of p56(Lck).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15499549 2004 Mutations in the X-linked cyclin-dependent kinase-like 5 (CDKL5/STK9) gene are associated with severe neurodevelopmental retardation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.
9000130 1996 Molecular cloning of the epidermal growth factor-stimulated protein kinase p56 KKIAMRE.
7721825 1995 Identification of the major tyrosine kinase substrate in signaling complexes formed after engagement of Fc gamma receptors.