Property Summary

Ligand Count 2
NCBI Gene PubMed Count 14
PubMed Score 6.41
PubTator Score 34.99

Knowledge Summary

Patent (20,339)

TINX Plot

  Disease (2)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.400 4.9e-03
atypical teratoid / rhabdoid tumor -1.700 2.9e-05
colon cancer -1.900 2.4e-03
cystic fibrosis -1.277 3.7e-05
glioblastoma -1.300 3.6e-03
interstitial cystitis -1.100 8.5e-03
lung cancer -2.200 2.9e-05
medulloblastoma -1.500 6.7e-05
oligodendroglioma -1.100 1.3e-02
osteosarcoma -2.272 4.8e-08
primitive neuroectodermal tumor -1.600 1.0e-03
psoriasis -3.000 3.3e-05

Gene RIF (3)

AA Sequence

MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVF      1 - 70
RRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVI     71 - 140
KLCDFGFARLLAGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQ    141 - 210
LYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTQRLTCEQ    211 - 280
LLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKL    281 - 350
NYRFPNI                                                                   351 - 357
//

Text Mined References (17)

PMID Year Title