Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.41
PubTator Score 34.99

Knowledge Summary

Patent (20,339)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.400 4.9e-03
oligodendroglioma -1.100 1.3e-02
psoriasis -3.000 3.3e-05
osteosarcoma -2.280 1.4e-05
cystic fibrosis -1.277 3.7e-05
atypical teratoid / rhabdoid tumor -1.700 2.9e-05
glioblastoma -1.300 3.6e-03
medulloblastoma -1.500 6.7e-05
primitive neuroectodermal tumor -1.600 1.0e-03
colon cancer -1.900 2.4e-03
lung cancer -2.200 2.9e-05
interstitial cystitis -1.300 1.0e-03

Gene RIF (3)

PMID Text
22804458 CDKL1 was overexpressed in breast cancer patients and had a positive detection efficiency of 77% (144/186).
22369697 High expression of CDKL1 protein was associated with gastric cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MEKYEKIGKIGEGSYGVVFKCRNRDTGQIVAIKKFLESEDDPVIKKIALREIRMLKQLKHPNLVNLLEVF      1 - 70
RRKRRLHLVFEYCDHTVLHELDRYQRGVPEHLVKSITWQTLQAVNFCHKHNCIHRDVKPENILITKHSVI     71 - 140
KLCDFGFARLLAGPSDYYTDYVATRWYRSPELLVGDTQYGPPVDVWAIGCVFAELLSGVPLWPGKSDVDQ    141 - 210
LYLIRKTLGDLIPRHQQVFSTNQYFSGVKIPDPEDMEPLELKFPNISYPALGLLKGCLHMDPTQRLTCEQ    211 - 280
LLHHPYFENIREIEDLAKEHNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKL    281 - 350
NYRFPNI                                                                   351 - 357
//

Text Mined References (17)

PMID Year Title
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
22804458 2012 Evaluation of cyclin-dependent kinase-like 1 expression in breast cancer tissues and its regulation in cancer cell growth.
22369697 2012 A role for Cdkl1 in the development of gastric cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15499549 2004 Mutations in the X-linked cyclin-dependent kinase-like 5 (CDKL5/STK9) gene are associated with severe neurodevelopmental retardation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9000130 1996 Molecular cloning of the epidermal growth factor-stimulated protein kinase p56 KKIAMRE.
7595554 1995 The distribution and biochemical properties of a Cdc2-related kinase, KKIALRE, in normal and Alzheimer brains.
1639063 1992 A family of human cdc2-related protein kinases.