Property Summary

NCBI Gene PubMed Count 164
PubMed Score 71.26
PubTator Score 86.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
breast carcinoma 1.300 1.0e-02
group 3 medulloblastoma 1.800 1.3e-03
lung cancer 1.100 6.3e-03
malignant mesothelioma 2.100 6.8e-08
medulloblastoma, large-cell 2.100 4.2e-03
pediatric high grade glioma 1.200 8.0e-05
psoriasis -2.900 6.8e-04

Protein-protein Interaction (7)

Gene RIF (161)

AA Sequence

MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRT      1 - 70
WGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVP     71 - 140
QAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKDNGRRLGGARLDLPKIRKNPLIEIISI    141 - 210
NTGCLNACTYCKTKHARGNLASYPIDELVDRAKQSFQEGVCEIWLTSEDTGAYGRDIGTNLPTLLWKLVE    211 - 280
VIPEGAMLRLGMTNPPYILEHLEEMAKILNHPRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLK    281 - 350
EKVPGITIATDIICGFPGETDQDFQETVKLVEEYKFPSLFINQFYPRPGTPAAKMEQVPAQVKKQRTKDL    351 - 420
SRVFHSYSPYDHKIGERQQVLVTEESFDSKFYVAHNQFYEQVLVPKNPAFMGKMVEVDIYESGKHFMKGQ    421 - 490
PVSDAKVYTPSISKPLAKGEVSGLTKDFRNGLGNQLSSGSHTSAASQCDSASSRMVLPMPRLHQDCALRM    491 - 560
SVGLALLGLLFAFFVKVYN                                                       561 - 579
//

Text Mined References (169)

PMID Year Title