Property Summary

Ligand Count 169
NCBI Gene PubMed Count 245
PubMed Score 918.28
PubTator Score 371.20

Knowledge Summary

Patent (62,312)

Expression

  Differential Expression (1)

Disease log2 FC p
Gaucher disease type 3 1.100 6.2e-04

PDB (22)

Gene RIF (290)

AA Sequence

MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKIL      1 - 70
QLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYI     71 - 140
HRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPI    141 - 210
DLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLK    211 - 280
AYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQIT    281 - 350
QQSTNQSRNPATTNQTEFERVF                                                    351 - 372
//

Text Mined References (269)

PMID Year Title