Property Summary

Ligand Count 23
NCBI Gene PubMed Count 124
PubMed Score 219.02
PubTator Score 507.36

Knowledge Summary

Patent (20,663)

Expression

Synonym

Accession P50613 Q9BS60 Q9UE19
Symbols CAK
CAK1
HCAK
MO15
STK1
CDKN7
p39MO15

Gene

Gene RIF (64)

AA Sequence

MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELS      1 - 70
HPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKP     71 - 140
NNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRV    141 - 210
PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNP    211 - 280
CARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF        281 - 346
//

Text Mined References (147)

PMID Year Title