Property Summary

NCBI Gene PubMed Count 222
PubMed Score 362.18
PubTator Score 374.93

Knowledge Summary

Patent (29,832)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Rheumatoid Arthritis 1170 0.0 1.0
Disease Target Count Z-score Confidence
Microcephaly 149 0.0 4.0
Disease Target Count Z-score Confidence
Cancer 2346 5.654 2.8

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid Arthritis 1.500 7.8e-03
glioblastoma 3.100 2.7e-04
urothelial carcinoma -1.300 6.0e-04
osteosarcoma 1.747 2.5e-02
ependymoma 1.400 8.7e-03
group 3 medulloblastoma 4.700 1.6e-06
cystic fibrosis -2.210 5.8e-03
atypical teratoid / rhabdoid tumor 4.000 1.6e-07
medulloblastoma, large-cell 4.600 6.0e-05
primitive neuroectodermal tumor 3.900 4.7e-05
adrenocortical adenoma 1.204 6.4e-03
primary pancreatic ductal adenocarcinoma 1.324 5.2e-03
tuberculosis 1.400 4.4e-06
intraductal papillary-mucinous adenoma (... 1.700 6.9e-03
intraductal papillary-mucinous carcinoma... 1.800 3.0e-02
lung cancer 2.700 3.1e-05
sarcoidosis 1.200 7.6e-03
pediatric high grade glioma 2.800 3.2e-05
pilocytic astrocytoma 2.400 1.3e-06
acute myeloid leukemia 1.100 2.8e-02
lung adenocarcinoma -1.100 1.5e-04
psoriasis -1.100 2.3e-06
lung carcinoma 1.100 2.5e-11
Breast cancer -2.100 9.0e-06
invasive ductal carcinoma -1.100 2.5e-02
ovarian cancer -2.600 8.2e-06
pancreatic cancer 1.500 6.0e-03

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (151)

PMID Text
26857361 This review highlights our current understanding of CDK signaling in both normal and malignant breast tissues, with special attention placed on recent clinical advances in inhibition of CDK4/6 in ER+ disease
26822763 Results show that NEAT1 regulated CDK6 expression in laryngeal squamous cell cancer (LSCC) cells which was mediated by miR-107; NEAT1 plays an oncogenic role in the tumorigenesis of LSCC.
26644182 PHD1 is phosphorylated by CDK2, CDK4 and CDK6 at Serine 130.
26542173 A ZFP36L1-mediated regulatory circuit through repressing CDK6 expression.
26503549 three uniquely identified proteins (CDK6 , galectin-3-binding protein and LDH C) were found, which show tight connection with prostate cancer and presence of all of them was previously linked to certain aspects of prostate cancer
26498144 Data indicate that microRNA miR-214 has tumor-suppressive activity in hepatocellular carcinoma (HCC) through inhibition of E2F2 transcription factor (E2F2), cyclin-dependent kinases CDK3 and CDK6.
26494299 MiR-26a and mir-584 inhibit the binding of hnRNP A1-CDK6 mRNA and induce colorectal cancer cell apoptosis.
26369631 The concept that cotargeting MEK and CDK4/6 would prove efficacious in KRAS-mutant (KRAS(mt)) colorectal cancers.
26352175 Downregulation of microRNA33a promotes the expression CDK6, CCND1, and PIM1, and gastric cancer cell proliferation.
26278580 These data enhance our understanding of the important role that GAS5 plays in the molecular etiology of GC and suggest a potential of GAS5 as a new therapeutic target for GC treatment.
26104764 only miR-34a was prognostic for RFS (RR, 11.5; P = 0.027). miR-34a expression was inversely correlated with that of c-MET and CDK6 in non-small cell lung cancer , and had prognostic significance for RFS, especially in adenocarcinoma patients.
26025442 We conclude that Bz-surviving MM cells display a GRP78(HIGH)/p21(HIGH)/CDK6(LOW)/P-Rb(LOW) profile, and these markers may identify quiescent MM cells capable of fueling recurrences.
25991817 concurrent inhibition of ESR1 and the cyclin-dependent kinases 4 and 6 (CDK4/6) significantly increased progression-free survival in advanced patients
25927932 The CDK6-cyclin D3 pair play a fundamental role in controlling CDK2-dependent SAMHD1 phosphorylation and the dNTP pool in primary macrophages.
25889927 MiR-211 is a tumor suppressor that controls expression of Cyclin D1 and CDK6.
25876993 The results of clinical trials with oral CDK4/6 inhibitors to date have offered promising glimpses of significant activity in hormone-sensitive breast cancer.
25817794 that re-introducing CDK6, cyclin-D1 or cyclin-D2 expression partially, but significantly, rescues cells from the suppression of cell proliferation and cell cycle arrest mediated by miR-340
25744718 Selective and reversible inhibition of CDK4/CDK6 as an effective means to enhance Ara-C killing of AML cells.
25704240 differential expression of CDK6 underlies heterogeneity in stem cell quiescence states that functionally regulates this highly regenerative system
25703099 lower expression in cisplatin-resistant non-small-cell lung carcinoma
25577249 Our data suggest that miR-377 can suppress proliferation in MG-63 cells in part by targeting CDK6.
25524798 The addition of CDK4/6 inhibitor palbociclib to letrozole in this phase 2 study significantly improved progression-free survival in women with advanced oestrogen receptor-positive and HER2-negative breast cancer.
25425654 Cooperation of DLC1 and CDK6 affects breast cancer clinical outcome
25319577 LINE-1 hypomethylation was associated with a higher cancer recurrence and CDK6 messenger RNA expression levels were inversely associated with LINE-1 methylation in hepatocellular carcinomas.
25178497 miR-320c could inhibit the proliferation, migration and invasion of bladder cancer cells via regulating CDK6.
25138370 genetic variants in CDK6 and PADI4 were associated with anti-citrullinated cyclic peptide status in rheumatoid arthritis DRB1*04 negative patients
25015816 these findings identify a direct relationship between control of the cell cycle by CDK6 and SAMHD1 activity, which is important for replication of lentiviruses, as well as other viruses whose replication may be regulated by intracellular dNTP availability.
25002028 The combination of PI3K and CDK 4/6 inhibitors overcomes intrinsic and adaptive resistance leading to tumor regressions in PIK3CA mutant xenografts.
24953629 SUMO1 modification stabilizes CDK6 protein and drives the cell cycle and glioblastoma progression.
24848372 G1-phase cyclin-dependent kinases CDK4 and CDK6 modulate expression of genes encoding estrogen metabolizing enzymes in human breast cancer cells.
24764564 data identify CDK6 as critical effector of MLL fusions in leukemogenesis that might be targeted to overcome the differentiation block associated with MLL-rearranged acute myeloid leukemia
24736461 CDK6 is a direct target of MLL fusion proteins, playing an important role in the proliferation advantage of MLL-rearranged ALL cells.
24647829 results suggest that DCK6 is a putative target of miR504 in of hypopharyngeal squamous cell carcinoma.
24610393 overexpression of hsa-miR-4516 downregulates STAT3, p-STAT3, CDK6, and UBE2N proteins that are consistently upregulated in psoriasis and induces apoptosis in HaCaT cells.
24604117 CDK4 and CDK6 are direct targets of miR-506, and miR-506 can inhibit CDK4/6-FOXM1 signalling, which is activated in the majority of serous ovarian carcinomas.
24510775 Findings begin to elucidate the role of miR-145 as an important regulator of chemoresistance in ovarian cancer by controlling both Cdk6 and Sp1.
24495407 In 47 melanoma cell lines homozygous loss, methylation or mutation of CDKN2A gene or loss of protein (p16(INK) (4A) ) predicted sensitivity to the CDK4/6 inhibitor PD0332991, while RB1 loss predicted resistance.
24444383 MYC-dependent breast cancer cells possess high MYC expression and high level of MYC phosphorylation, but are not sensitive to inhibition of CDK6.
24423610 cases with CDK6-positive expression experienced worse clinical outcome compared with those with CDK6-negative expression, supporting the oncogenic role of CDK6 in ESCC.
24389100 CDK6 physically and functionally interacts with the NF-kappaB subunit p65 in the nucleus and is found at promoters of many transcriptionally active NF-kappaB target genes.
24383407 results showed that let-7a acted as a tumor suppressor in ES by targeting CDK6, and it may provide novel diagnostic and therapeutic options for human Ewing sarcoma clinical operation in future
24347572 CDK6 rs42041 was associated with a remitting course of juvenile idiopathic arthritis.
24196439 This interaction suggests that CDK6 regulates EYA2 activity, a mechanism that could be important in development and in cancer.
24169358 The study revealed that Fulvestrant resistance is associated with the dysregulation of GPER and CDK6 in breast cancer cells.
24161991 An evolving tumor can only derive full benefit from from overexpression of CDK6 in the absence of P16INK4A.
24069260 Downregulation of GAS5 promotes bladder cancer cell proliferation, partly by regulating CDK6.
24026436 Gas5 negatively regulates CDK6 (cyclin-dependent kinase 6) expression in vitro and in vivo in pancreatic cancer cells.
24009066 CDK6 was identified as a novel functional target of miR200a. Our data indicate that miR200a functions as a potential tumor suppressor in HCC.
23950948 Data indicate CDK6 as a putative target of miR-105 which is likely a main contributor to the inhibition of tumour cell growth observed in our assays.
23948297 The finding that CDK6 connects cell-cycle progression to angiogenesis confirms CDK6's central role in hematopoietic malignancies.
23918663 We propose that the identified CDK6 mutation leads to reduced cell proliferation and impairs the correct functioning of the centrosome in microtubule organization and its positioning near the nucleus which are key determinants during neurogenesis.
23892592 CDK6 and XRCC1, were significantly associated with dysplastic nevi, whereas neither gene was significantly associated with cutaneous malignant melanoma.
23839043 Cyclin D1 and CDK4/6 have alternate roles in regulation of migration and cancer stem-like cell activity.
23783093 The decrease of sTWEAK in severely obese patients may favor the proinflammatory activity elicited by TNFalpha.
23737530 Data indicate that depletion of NFATc1, cyclin D1, CDK6, or CDK4 levels attenuated MCP1-induced Pak1 phosphorylation/activation and resulted in decreased aortic smooth muscle cells (HASMCs) F-actin stress fiber formation, migration, and proliferation.
23707559 EZH2-mediated signal loop, EZH2-CDK4/6-pRb-E2F1, is probably involved in GBM tumorigenicity, and this loop can be blocked by miRNA-138
23644744 We found a genome-wide significant association for rs2282987 in CDK6 and a consistent association for rs2706748 in SH3RF1 .
23594394 High CDK6 expression is associated with glioblastoma multiforme.
23178718 Combined statistical coupling analysis and molecular dynamics simulations on the CDK6-CDKN2A complex to evaluate coevolution between proteins. Most of the coevolved residue pairs are spatially proximal.
23178712 Data suggest that microRNA 137 influences cell proliferation via regulation of expression of CDK6 and CDC42 (cell division cycle protein 42); expression of microRNA 137 in lung cancer cells downregulates CDK6/CDC42 and induces G1 cell cycle arrest.
23172372 High CDK6 expression is associated with medulloblastoma.
23166591 Expression of HIV-1 Tat downregulates the abundance of cyclin-dependent kinase 6 (CDK6) in the nucleoli of Jurkat T-cells
23023438 The present paper is a summary on possible involvement of TDP-43 in various neurodegenerative disorders.
22893700 Protein kinase N1 is a novel substrate of NFATc1-mediated cyclin D1-CDK6 activity and modulates vascular smooth muscle cell division and migration leading to inward blood vessel wall remodeling.
22736304 CDK6 is an important mediator of glioma resistance to chemotherapy.
22733811 CDK4/6 inhibition can antagonize cytotoxic therapeutic strategies and increases utilization of error-prone DNA repair mechanisms that could contribute to disease progression.
22683624 miR-191 overexpression is sufficient to induce senescence in HEKn cells and that the direct targets, involved in this process, are the Special AT-rich Binding protein 1 (SATB1) and the Cyclin Dependent Kinase 6 (CDK6) mRNAs.
22623979 Inactivation of CDK6/pRb pathway normalizes survival pattern of lymphoblasts expressing the FTLD-progranulin mutation c.709-1G>A
22476749 CDK6 overexpression driven by gene amplification on 7q is associated with myxofibrosarcomas.
22088371 An aberrant decrease of miR-218 expression may lead to an increase of CDK6 expression and proliferative activity of giloma cells.
22012619 through regulation of expression of DNA damage response genes, CycK/Cdk12 protects cells from genomic instability
21803798 In CDK6 in isolated growth hormone deficiency we found only known polymorphisms
21628465 a mechanism for LPS signaling which involves a decrease in miR-107 leading to an increase in CDK6
21593195 both CDK4 and CDK6 are prognostic markers and bona fide oncogenes in EAC.
21586211 The results obtained through a cohort of European Caucasian Systemic sclerosis patients do not support the implication of CDK6 gene in the pathogenesis of SSc but the gene were identified as Rheumatoid arthritis susceptibility gene.
21555518 CDK6 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21455311 Study elucidates a model to regulate glioma cell cycle progression in which hUCBSC acts to control cyclin D1 induction and in concert its partner kinases, Cdk 4 and Cdk 6 by mediating cell cycle arrest at G(0)-G(1) phase.
21278246 p16 and retinoblastoma determines response to CDK4/6 inhibition in ovarian cancer
21264532 High CDK6 is associated with gastric cancer invasion.
21172447 Epigenetic regulation of the hsa-miR-124a microRNA (most frequently methylated in the acute lymphoblastic leukemia patients) mediates the increased expression of CDK6 and contributes to the abnormal proliferation of cells both in vitro and in vivo.
21062975 Data show that miR-302 simultaneously suppressed both the cyclin E-CDK2 and cyclin D-CDK4/6 pathways to block>70% of the G1-S cell cycle transition.
21053367 The functional analysis showed that this fragment like p16 can interact with CDK4/6, block the entry into S phase of the cell cycle and suppress growth as indicated by colony formation assay.
21042715 Cyclin D1 and cyclin D-dependent kinases enhance oral keratinocyte proliferation but do not block keratinocyte differentiation.
20861610 pRb controls the cell cycle as tumor suppressor
20846217 Observational study of gene-disease association. (HuGE Navigator)
20736297 Targeted inhibition of CDK4 activity may have a role in the treatment of cyclin D-overexpressing breast cancers.
20630868 The level of cyclin-dependent kinase 6 (CDK6) is dramatically and selectively elevated in parkin-expressing breast cancer cells, the extent of which correlates well with the expression of parkin.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20618617 For cdk6 staining, the prevalence of positive cases and the percentage of positive cells in normal mucosa were significantly lower than oral squamous cell carcinoma.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20534551 analysis of a subset of glioblastoma multiforme likely to respond to CDK4/6 inhibition
20496072 lower expression in dysplastic nevi than in melanomas, but higher than in common nevi
20453000 Observational study of gene-disease association. (HuGE Navigator)
20439292 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20354191 cyclin-dependent kinase 4 and 6 inhibition arrests the growth of glioblastoma multiforme intracranial xenografts
20333249 KSHV v-cyclin and cellular CDK6 kinase phosphorylate NPM on threonine 199 (Thr199) in de novo and naturally Kaposi sarcoma herpesvirus-infected cells
20331971 These data suggest that the functional availability of Kaposi's sarcoma-associated herpesvirus K-cyclin is largely dependent on the balance in expression between cellular CDK6 and p16INK4a.
20233754 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20100483 CDK4/6 inhibition is a potent mediator of cytostasis and that RB loss can be readily compensated for in the context of both hepatoma cell lines and liver tissue.
20086245 miR-29 inhibits CDK6 protein & mRNA levels by direct binding to 3'-untranslated region. Inverse correlation between miR-29 & CDK6 was observed in mantle-cell lymphoma.
20049410 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19863319 The majority of tumours showed strong p16, p21, p27, pRb and cyclin D1 staining and little or no p53 expression. Tumours harbouring dysplasia were significantly more likely to be p53-positive and exhibit up-regulated p21 and p27.
19838216 Data show that SHP-1 knockdown increases p27stability, decreases the CDK6 levels, inducing retinoblastoma protein hypophosphorylation, downregulation of cyclin E and thereby a decrease in the CDK2 activity.
19833767 miR-449a/b targets and inhibits oncogenic CDK6 and CDC25A, resulting in pRb dephosphorylation and cell cycle arrest at G1 phase, revealing a negative feedback regulation of the pRb-E2F1 pathway
19738611 Observational study of gene-disease association. (HuGE Navigator)
19674979 Observational study of gene-disease association. (HuGE Navigator)
19644859 Observational study of gene-disease association. (HuGE Navigator)
19584075 Observational study of gene-disease association. (HuGE Navigator)
19487459 Results show that substituting a proline for the corresponding residue of CDK6 enforced its complete, apparently cyclin-independent T177 phosphorylation and dramatically increased its activity.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19435910 Grounds for new therapeutic strategies in acute lymphoblastic leukemia either by targeting the epigenetic regulation of microRNAs and/or directly targeting the CDK6 pathway.
19407485 MicroRNA repression is associated with repression of CDK6 in pancreatic cancer.
19266077 Observational study of gene-disease association. (HuGE Navigator)
19145199 Report clinicopathologic features of CDK6 translocation-associated B-cell lymphoproliferative disorders.
19136653 Cdk-6 overexpression, alone or in combination with cyclin D1, strikingly stimulates human beta-cell replication, both in vitro as well as in vivo, without inducing cell death or loss of function.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19110536 Observational study of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
19040567 Proliferation parameters of differentiating cells correlate with the activity and structure of cyclin A/E-CDK2 but not of cyclin D-CDK4/6-p27 complexes.
18823025 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18794853 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
18776921 CDK4/6 activity is important in regulating the expression of these critical mediators of DNA replication
18607543 CDK6 is regulated by microRNA 124 in medulloblastoma and that miR 124 modulates medulloblastoma cell growth.
18507837 Observational study of gene-disease association. (HuGE Navigator)
18504428 Tax-induced cell-cycle progression in T cells is mediated, at least in part, through cell-type-specific activation of the cyclin D2 and cdk6 genes through NF-kappaB and may be important for the cell-type-specific oncogenesis.
18497076 Amplification of CDK6 is associated with type I endometrial carcinoma tumors
18438866 high-resolution genomic analysis and immunoprofiling identify CDK6 as the main candidate target for the recurrent amplification of 7q21 in GEJ adenocarcinomas
18406353 miR-34a reduces both mRNA and protein levels of cyclin D1 (CCND1) and cyclin-dependent kinase 6 (CDK6).
18398432 An atypical nevus susceptibility gene has been mapped to chromosome band 7q21.3 containing CDK6.
18391952 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18361427 Observational study of gene-disease association. (HuGE Navigator)
18305152 Cdk6 up-regulation in TDP-43-depleted cells is accompanied by an increase in phosphorylation of two of its major targets, the retinoblastoma protein pRb and pRb-related protein pRb2/p130.
18281541 Observational study of gene-disease association. (HuGE Navigator)
18174243 Observational study of gene-disease association. (HuGE Navigator)
18003885 cdk phosphorylation of RUNX1 potentially couples stem/progenitor proliferation and lineage progression
17989712 Amplification of the CDK6 locus was analyzed in primary T-cell lymphoma samples and, while detected infrequently in those classified as ALCL (1%), was detected in 23% of peripheral T-cell lymphomas not otherwise specified.
17909067 Observational study of gene-disease association. (HuGE Navigator)
17420273 CDK6 delays senescence by kinase-dependent and p16INK4a-independent mechanisms.
17409409 Observational study of gene-disease association. (HuGE Navigator)
16314645 Overexpression of CDK6 correlated significantly with poor prognosis and represented an independent prognostic marker of overall survival in medulloblastoma.
15790678 CDK6 may play an important role in the development and/or progression of a subset of human prostate cancers by stimulating the activity of the AR.
15687240 c-Myb activity is directly regulated by cyclin D1 and CDKs and imply that c-Myb activity is regulated during the cell cycle in hematopoietic cells
15504546 the amount of CDK6 was reduced by TNF-alpha, while CDK6 and the FLICE-inhibitory protein (FLIP) were increased with SCF
14985467 cdk6 restrains rather than stimulates breast epithelial cell proliferation and that its loss or down-regulation could play a role in breast tumor development
14694185 cyclin-dependent kinase (CDK)2, -4, and -6 were down-regulated from the myelocytes/metamyelocytes stages and onward
12592386 Overexpression of transfected human Cdk6 & mouse cyclin D3 enhances susceptibility of BALB/c3T3 & C3H10T1/2 mouse fibroblast lines to UV radiation & 3-methylcholanthrene transformation.
12082615 Sequential extension of proliferative lifespan in human fibroblasts is induced by over-expression of CDK4 or 6 and loss of p53 function.
11940479 a patient with the dignosis of B-cell lymphoma with cdk6 expression is dysregulated mapping to chromosome 7.
11828325 crystal structure of human CDK6--Vcyclin in an active state was determined to 3.1 A resolution to better understand the structural basis of CDK6 activation by viral cyclins
11739795 KSHV-cyclin can activate CDK6 independent of phosphorylation by CAK in vitro

AA Sequence

MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLET      1 - 70
FEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHR     71 - 140
VVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFA    141 - 210
EMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKC    211 - 280
LTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA                            281 - 326
//

Text Mined References (236)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26857361 2016 Targeting the cyclin-dependent kinases (CDK) 4/6 in estrogen receptor-positive breast cancers.
26822763 2016 Long noncoding RNA NEAT1 promotes laryngeal squamous cell cancer through regulating miR-107/CDK6 pathway.
26644182 2016 CDK-dependent phosphorylation of PHD1 on serine 130 alters its substrate preference in cells.
26542173 2015 ZFP36L1 promotes monocyte/macrophage differentiation by repressing CDK6.
26503549 2015 Differences in urinary proteins related to surgical margin status after radical prostatectomy.
26498144 2016 miR-214/199a/199a* cluster levels predict poor survival in hepatocellular carcinoma through interference with cell-cycle regulators.
26494299 2015 microRNA-26a and -584 inhibit the colorectal cancer progression through inhibition of the binding of hnRNP A1-CDK6 mRNA.
26369631 2016 Sensitivity of KRAS-Mutant Colorectal Cancers to Combination Therapy That Cotargets MEK and CDK4/6.
26352175 2015 Downregulation of microRNA?33a promotes cyclin?dependent kinase 6, cyclin D1 and PIM1 expression and gastric cancer cell proliferation.
26278580 2015 GAS5 Inhibits Gastric Cancer Cell Proliferation Partly by Modulating CDK6.
26104764 2015 The expression of microRNA-34a is inversely correlated with c-MET and CDK6 and has a prognostic significance in lung adenocarcinoma patients.
26025442 2015 Identification of markers that functionally define a quiescent multiple myeloma cell sub-population surviving bortezomib treatment.
25991817 2015 Efficacy of SERD/SERM Hybrid-CDK4/6 Inhibitor Combinations in Models of Endocrine Therapy-Resistant Breast Cancer.
25927932 2015 Cyclin D3-dependent control of the dNTP pool and HIV-1 replication in human macrophages.
25889927 2015 miR-211 suppresses epithelial ovarian cancer proliferation and cell-cycle progression by targeting Cyclin D1 and CDK6.
25876993 2015 The Role of CDK4/6 Inhibition in Breast Cancer.
25817794 2015 miR-340 inhibits glioblastoma cell proliferation by suppressing CDK6, cyclin-D1 and cyclin-D2.
25744718 2015 CDK4/6 Inhibitor PD 0332991 Sensitizes Acute Myeloid Leukemia to Cytarabine-Mediated Cytotoxicity.
25704240 2015 CDK6 levels regulate quiescence exit in human hematopoietic stem cells.
25703099 2015 miR Profiling Identifies Cyclin-Dependent Kinase 6 Downregulation as a Potential Mechanism of Acquired Cisplatin Resistance in Non-Small-Cell Lung Carcinoma.
25577249 2015 microRNA-377 suppresses the proliferation of human osteosarcoma MG-63 cells by targeting CDK6.
25524798 2015 The cyclin-dependent kinase 4/6 inhibitor palbociclib in combination with letrozole versus letrozole alone as first-line treatment of oestrogen receptor-positive, HER2-negative, advanced breast cancer (PALOMA-1/TRIO-18): a randomised phase 2 study.
25425654 2014 Cooperation of DLC1 and CDK6 affects breast cancer clinical outcome.
25416956 2014 A proteome-scale map of the human interactome network.
25319577 2015 LINE-1 methylation level and patient prognosis in a database of 208 hepatocellular carcinomas.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25178497 2014 MicroRNA-320c inhibits tumorous behaviors of bladder cancer by targeting Cyclin-dependent kinase 6.
25138370 2014 Non-HLA genes PTPN22, CDK6 and PADI4 are associated with specific autoantibodies in HLA-defined subgroups of rheumatoid arthritis.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25015816 2014 Cell cycle control and HIV-1 susceptibility are linked by CDK6-dependent CDK2 phosphorylation of SAMHD1 in myeloid and lymphoid cells.
25002028 2014 CDK 4/6 inhibitors sensitize PIK3CA mutant breast cancer to PI3K inhibitors.
24953629 2014 SUMO1 modification stabilizes CDK6 protein and drives the cell cycle and glioblastoma progression.
24855949 2014 A code for RanGDP binding in ankyrin repeats defines a nuclear import pathway.
24848372 2014 Modulated expression of genes encoding estrogen metabolizing enzymes by G1-phase cyclin-dependent kinases 6 and 4 in human breast cancer cells.
24764564 2014 Requirement for CDK6 in MLL-rearranged acute myeloid leukemia.
24736461 2014 MLL fusion-driven activation of CDK6 potentiates proliferation in MLL-rearranged infant ALL.
24647829 2014 microRNA-504 inhibits cancer cell proliferation via targeting CDK6 in hypopharyngeal squamous cell carcinoma.
24610393 2014 hsa-miR-4516 mediated downregulation of STAT3/CDK6/UBE2N plays a role in PUVA induced apoptosis in keratinocytes.
24604117 2014 MiR-506 suppresses proliferation and induces senescence by directly targeting the CDK4/6-FOXM1 axis in ovarian cancer.
24510775 2014 miR-145 sensitizes ovarian cancer cells to paclitaxel by targeting Sp1 and Cdk6.
24495407 2014 Loss of CDKN2A expression is a frequent event in primary invasive melanoma and correlates with sensitivity to the CDK4/6 inhibitor PD0332991 in melanoma cell lines.
24444383 2014 Targeting cyclin-dependent kinase 1 (CDK1) but not CDK4/6 or CDK2 is selectively lethal to MYC-dependent human breast cancer cells.
24423610 2014 LINE-1 hypomethylation, DNA copy number alterations, and CDK6 amplification in esophageal squamous cell carcinoma.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24389100 2014 Cyclin-dependent kinase 6 is a chromatin-bound cofactor for NF-?B-dependent gene expression.
24383407 2014 Let-7a functions as a tumor suppressor in Ewing's sarcoma cell lines partly by targeting cyclin-dependent kinase 6.
24347572 2014 Genetic variation in VTCN1 (B7-H4) is associated with course of disease in juvenile idiopathic arthritis.
24196439 2014 CDK6 binds and promotes the degradation of the EYA2 protein.
24169358 2013 Fulvestrant induces resistance by modulating GPER and CDK6 expression: implication of methyltransferases, deacetylases and the hSWI/SNF chromatin remodelling complex.
24161991 2013 CDK6 and p16INK4A in lymphoid malignancies.
24069260 2013 Downregulation of GAS5 promotes bladder cancer cell proliferation, partly by regulating CDK6.
24026436 2013 Downregulation of gas5 increases pancreatic cancer cell proliferation by regulating CDK6.
24009066 2013 microRNA-200a is an independent prognostic factor of hepatocellular carcinoma and induces cell cycle arrest by targeting CDK6.
23950948 2013 miR-105 inhibits prostate tumour growth by suppressing CDK6 levels.
23948297 2013 A kinase-independent function of CDK6 links the cell cycle to tumor angiogenesis.
23918663 2013 CDK6 associates with the centrosome during mitosis and is mutated in a large Pakistani family with primary microcephaly.
23892592 2014 Association of genetic variants in CDK6 and XRCC1 with the risk of dysplastic nevi in melanoma-prone families.
23839043 2013 Cell cycle regulators cyclin D1 and CDK4/6 have estrogen receptor-dependent divergent functions in breast cancer migration and stem cell-like activity.
23783093 2013 The rise of soluble TWEAK levels in severely obese subjects after bariatric surgery may affect adipocyte-cytokine production induced by TNF?.
23737530 2013 Nuclear factor of activated T cells c1 mediates p21-activated kinase 1 activation in the modulation of chemokine-induced human aortic smooth muscle cell F-actin stress fiber formation, migration, and proliferation and injury-induced vascular wall remodeling.
23707559 2013 Suppression of tumorigenicity by microRNA-138 through inhibition of EZH2-CDK4/6-pRb-E2F1 signal loop in glioblastoma multiforme.
23644744 2013 Imputation-based association analyses identify new lung cancer susceptibility variants in CDK6 and SH3RF1 and their interactions with smoking in Chinese populations.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23594394 2013 MicroRNA-495 inhibits proliferation of glioblastoma multiforme cells by downregulating cyclin-dependent kinase 6.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23178718 2013 Molecular dynamics simulations and statistical coupling analysis reveal functional coevolution network of oncogenic mutations in the CDKN2A-CDK6 complex.
23178712 2013 miR-137 inhibits the proliferation of lung cancer cells by targeting Cdc42 and Cdk6.
23172372 2013 Expression of miR-124 inhibits growth of medulloblastoma cells.
23023438 [TDP-43 proteinopathies - from frontotemporal lobar degeneration to inclusion body myositis].
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22893700 2012 Protein kinase N1 is a novel substrate of NFATc1-mediated cyclin D1-CDK6 activity and modulates vascular smooth muscle cell division and migration leading to inward blood vessel wall remodeling.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22736304 2012 Knockdown of CDK6 enhances glioma sensitivity to chemotherapy.
22733811 2012 Modification of the DNA damage response by therapeutic CDK4/6 inhibition.
22683624 2012 MicroRNA-191 triggers keratinocytes senescence by SATB1 and CDK6 downregulation.
22623979 2012 Inactivation of CDK/pRb pathway normalizes survival pattern of lymphoblasts expressing the FTLD-progranulin mutation c.709-1G>A.
22476749 2012 Recurrent amplification at 7q21.2 Targets CDK6 gene in primary myxofibrosarcomas and identifies CDK6 overexpression as an independent adverse prognosticator.
22094256 2011 A systematic screen for CDK4/6 substrates links FOXM1 phosphorylation to senescence suppression in cancer cells.
22088371 2011 [Relationship between miR-218 and CDK6 expression and their biological impact on glioma cell proliferation and apoptosis].
22012619 2011 The Cyclin K/Cdk12 complex maintains genomic stability via regulation of expression of DNA damage response genes.
21803798 2011 Isolated GH deficiency: mutation screening and copy number analysis of HMGA2 and CDK6 genes.
21738479 2011 Genome-wide association study of white blood cell count in 16,388 African Americans: the continental origins and genetic epidemiology network (COGENT).
21738478 2011 Identification of nine novel loci associated with white blood cell subtypes in a Japanese population.
21628465 2011 Toll-like receptor-4 (TLR4) down-regulates microRNA-107, increasing macrophage adhesion via cyclin-dependent kinase 6.
21593195 2011 Early G? cyclin-dependent kinases as prognostic markers and potential therapeutic targets in esophageal adenocarcinoma.
21586211 Association study of 3 rheumatoid arthritis risk loci in systemic sclerosis in European Caucasian population.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21455311 2011 Regulation of glioblastoma progression by cord blood stem cells is mediated by downregulation of cyclin D1.
21319271 2011 Cdk6-dependent regulation of G(1) length controls adult neurogenesis.
21278246 2011 Expression of p16 and retinoblastoma determines response to CDK4/6 inhibition in ovarian cancer.
21269460 2011 Initial characterization of the human central proteome.
21264532 2012 miR-107 targets cyclin-dependent kinase 6 expression, induces cell cycle G1 arrest and inhibits invasion in gastric cancer cells.
21172447 2011 microRNA methylation profile has prognosis impact in acute lymphoblastic leukemia patients undergoing stem cell transplantation.
21062975 2010 MicroRNA miR-302 inhibits the tumorigenecity of human pluripotent stem cells by coordinate suppression of the CDK2 and CDK4/6 cell cycle pathways.
21053367 2010 C-terminal domain of p16(INK4a) is adequate in inducing cell cycle arrest, growth inhibition and CDK4/6 interaction similar to the full length protein in HT-1080 fibrosarcoma cells.
21042715 2010 Cyclin D1 and cyclin D-dependent kinases enhance oral keratinocyte proliferation but do not block keratinocyte differentiation.
21038853 2010 4-(Pyrazol-4-yl)-pyrimidines as selective inhibitors of cyclin-dependent kinase 4/6.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20861610 2011 Immunohistochemical expression of retinoblastoma protein and p16 in renal cell carcinoma.
20846217 2010 Association of linear growth impairment in pediatric Crohn's disease and a known height locus: a pilot study.
20736297 2010 Cyclin-dependent kinase 4-mediated phosphorylation inhibits Smad3 activity in cyclin D-overexpressing breast cancer cells.
20668294 2010 Induction of human beta-cell proliferation and engraftment using a single G1/S regulatory molecule, cdk6.
20630868 2010 Parkin enhances the expression of cyclin-dependent kinase 6 and negatively regulates the proliferation of breast cancer cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20618617 2010 Alteration in the expression of cdk4 and cdk6 proteins in oral cancer and premalignant lesions.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20534551 2010 Pattern of retinoblastoma pathway inactivation dictates response to CDK4/6 inhibition in GBM.
20496072 2010 Cyclin D1 and D3 expression in melanocytic skin lesions.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20439292 2010 Genetic variants in the prediction of rheumatoid arthritis.
20354191 2010 Pharmacologic inhibition of cyclin-dependent kinases 4 and 6 arrests the growth of glioblastoma multiforme intracranial xenografts.
20333249 2010 Nucleophosmin phosphorylation by v-cyclin-CDK6 controls KSHV latency.
20331971 2010 Functional availability of gamma-herpesvirus K-cyclin is regulated by cellular CDK6 and p16INK4a.
20233754 2010 Cumulative association of 22 genetic variants with seropositive rheumatoid arthritis risk.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20100483 2010 Proliferative suppression by CDK4/6 inhibition: complex function of the retinoblastoma pathway in liver tissue and hepatoma cells.
20086245 2010 microRNA expression profile and identification of miR-29 as a prognostic marker and pathogenetic factor by targeting CDK6 in mantle cell lymphoma.
20049410 2010 A functionally relevant IRF5 haplotype is associated with reduced risk to Wegener's granulomatosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19863319 2009 Expression of p53, p16INK4A, pRb, p21WAF1/CIP1, p27KIP1, cyclin D1, Ki-67 and HPV DNA in sinonasal endophytic Schneiderian (inverted) papilloma.
19838216 2010 Knockdown of protein tyrosine phosphatase SHP-1 inhibits G1/S progression in prostate cancer cells through the regulation of components of the cell-cycle machinery.
19833767 2009 miR-449a and miR-449b are direct transcriptional targets of E2F1 and negatively regulate pRb-E2F1 activity through a feedback loop by targeting CDK6 and CDC25A.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19674979 2010 Overlap of disease susceptibility loci for rheumatoid arthritis and juvenile idiopathic arthritis.
19644859 2009 Association of a single-nucleotide polymorphism in CD40 with the rate of joint destruction in rheumatoid arthritis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19584075 2009 Novel susceptibility loci for second primary tumors/recurrence in head and neck cancer patients: large-scale evaluation of genetic variants.
19487459 2009 Differential regulation of cyclin-dependent kinase 4 (CDK4) and CDK6, evidence that CDK4 might not be activated by CDK7, and design of a CDK6 activating mutation.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19435910 2009 Epigenetic silencing of the tumor suppressor microRNA Hsa-miR-124a regulates CDK6 expression and confers a poor prognosis in acute lymphoblastic leukemia.
19407485 2009 Epigenetic silencing of MicroRNA miR-107 regulates cyclin-dependent kinase 6 expression in pancreatic cancer.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19343178 2009 Meta-analysis of genome-wide scans for human adult stature identifies novel Loci and associations with measures of skeletal frame size.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
19238148 2009 Cell cycle, CDKs and cancer: a changing paradigm.
19145199 2009 Clinicopathologic features of CDK6 translocation-associated B-cell lymphoproliferative disorders.
19139263 2009 A role for NANOG in G1 to S transition in human embryonic stem cells through direct binding of CDK6 and CDC25A.
19136653 2009 Survey of the human pancreatic beta-cell G1/S proteome reveals a potential therapeutic role for cdk-6 and cyclin D1 in enhancing human beta-cell replication and function in vivo.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19110536 2009 Analysis of 17 autoimmune disease-associated variants in type 1 diabetes identifies 6q23/TNFAIP3 as a susceptibility locus.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19040567 2008 Lineage specific composition of cyclin D-CDK4/CDK6-p27 complexes reveals distinct functions of CDK4, CDK6 and individual D-type cyclins in differentiating cells of embryonic origin.
18823025 2008 Genetic variations in cell-cycle pathway and the risk of oral premalignant lesions.
18794853 2008 Common variants at CD40 and other loci confer risk of rheumatoid arthritis.
18776921 2008 Cyclin-dependent kinase 4/6 activity is a critical determinant of pre-replication complex assembly.
18607543 2008 Regulation of cyclin dependent kinase 6 by microRNA 124 in medulloblastoma.
18507837 2008 Effects of common germline genetic variation in cell cycle control genes on breast cancer survival: results from a population-based cohort.
18504428 2008 Activation of the cyclin D2 and cdk6 genes through NF-kappaB is critical for cell-cycle progression induced by HTLV-I Tax.
18497076 2008 Amplification studies of MET and Cdk6 in a rat endometrial tumor model and their correlation to human type I endometrial carcinoma tumors.
18495667 2008 Structure of a conserved dimerization domain within the F-box protein Fbxo7 and the PI31 proteasome inhibitor.
18438866 2008 Molecular dissection of the chromosome band 7q21 amplicon in gastroesophageal junction adenocarcinomas identifies cyclin-dependent kinase 6 at both genomic and protein expression levels.
18406353 2008 Downregulation of CCND1 and CDK6 by miR-34a induces cell cycle arrest.
18398432 2008 Genome-wide linkage scan for atypical nevi in p16-Leiden melanoma families.
18394558 2008 Feedback circuit among INK4 tumor suppressors constrains human glioblastoma development.
18391952 2008 Genome-wide association analysis identifies 20 loci that influence adult height.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
18361427 2008 Genetic variants in cell cycle control pathway confer susceptibility to bladder cancer.
18305152 2008 TDP-43 regulates retinoblastoma protein phosphorylation through the repression of cyclin-dependent kinase 6 expression.
18281541 2008 Effects of common germ-line genetic variation in cell cycle genes on ovarian cancer survival.
18174243 2008 Association of single-nucleotide polymorphisms in the cell cycle genes with breast cancer in the British population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18003885 2008 Cyclin-dependent kinase phosphorylation of RUNX1/AML1 on 3 sites increases transactivation potency and stimulates cell proliferation.
17989712 2008 Amplification at 7q22 targets cyclin-dependent kinase 6 in T-cell lymphoma.
17955473 2007 Proteomic analysis of p16ink4a-binding proteins.
17909067 2007 Association study of 69 genes in the ret pathway identifies low-penetrance loci in sporadic medullary thyroid carcinoma.
17909018 2007 A CDKN2A mutation in familial melanoma that abrogates binding of p16INK4a to CDK4 but not CDK6.
17517622 2007 Functional characterization of human PFTK1 as a cyclin-dependent kinase.
17431401 2007 Cdk6 blocks myeloid differentiation by interfering with Runx1 DNA binding and Runx1-C/EBPalpha interaction.
17420273 2007 CDK4 and CDK6 delay senescence by kinase-dependent and p16INK4a-independent mechanisms.
17409409 2007 Tagging single nucleotide polymorphisms in cell cycle control genes and susceptibility to invasive epithelial ovarian cancer.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16789739 2006 Toward understanding the structural basis of cyclin-dependent kinase 6 specific inhibition.
16767702 2006 Changes in motility, gene expression and actin dynamics: Cdk6-induced cytoskeletal changes associated with differentiation in mouse astrocytes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16548883 2006 Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection.
16314645 2005 Genomic and protein expression profiling identifies CDK6 as novel independent prognostic marker in medulloblastoma.
16294322 2006 Beyond the cell cycle: a new role for Cdk6 in differentiation.
16096642 2005 Transforming activity of Fbxo7 is mediated specifically through regulation of cyclin D/cdk6.
15809340 2005 Preferences for phosphorylation sites in the retinoblastoma protein of D-type cyclin-dependent kinases, Cdk4 and Cdk6, in vitro.
15790678 2005 Cyclin-dependent kinase 6 associates with the androgen receptor and enhances its transcriptional activity in prostate cancer cells.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15689157 2005 Crystal structure of a human cyclin-dependent kinase 6 complex with a flavonol inhibitor, fisetin.
15687240 2005 Positive and negative regulation of c-Myb by cyclin D1, cyclin-dependent kinases, and p27 Kip1.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15504546 2004 In human immature BFU-E tumor necrosis factor-alpha not only downregulates CDK6 but also directly produces apoptosis which is prevented by stem cell factor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254224 2004 Bone morphogenetic protein 2-induced osteoblast differentiation requires Smad-mediated down-regulation of Cdk6.
15232106 2004 Self-assembling protein microarrays.
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
14985467 2004 Cyclin-dependent kinase 6 inhibits proliferation of human mammary epithelial cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14694185 2004 End-stage differentiation of neutrophil granulocytes in vivo is accompanied by up-regulation of p27kip1 and down-regulation of CDK2, CDK4, and CDK6.
14627988 2003 Cyclin E and Bcl-xL cooperatively induce cell cycle progression in c-Rel-/- B cells.
12861051 2003 Expression of cyclin-dependent kinase 6, but not cyclin-dependent kinase 4, alters morphology of cultured mouse astrocytes.
12853948 2003 The DNA sequence of human chromosome 7.
12833137 2003 CDK6 blocks differentiation: coupling cell proliferation to the block to differentiation in leukemic cells.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12592386 2003 Overexpression of Cdk6-cyclin D3 highly sensitizes cells to physical and chemical transformation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12082615 2002 Sequential extension of proliferative lifespan in human fibroblasts induced by over-expression of CDK4 or 6 and loss of p53 function.
12006580 2002 Distinct phosphorylation events regulate p130- and p107-mediated repression of E2F-4.
11828325 2002 Structural basis for CDK6 activation by a virus-encoded cyclin.
11804329 2001 The expression and characterization of cyclin-dependent kinase 6 during the activation of murine G0 T-cells.
11739795 2001 CAK-independent activation of CDK6 by a viral cyclin.
11416152 2001 Differential regulation of retinoblastoma tumor suppressor protein by G(1) cyclin-dependent kinase complexes in vivo.
11374878 2001 Low levels of cyclin D and nonfunctional Rb protein affect cdk6 association with cyclin-dependent kinase inhibitor p27(Kip1).
11360184 2001 Cdk6-cyclin D3 complex evades inhibition by inhibitor proteins and uniquely controls cell's proliferation competence.
11358847 2001 Up-regulation of cyclin-dependent kinase 4/cyclin D2 expression but down-regulation of cyclin-dependent kinase 2/cyclin E in testicular germ cell tumors.
11124804 2000 Structural basis of inhibition of CDK-cyclin complexes by INK4 inhibitors.
10934208 2000 Dephosphorylation of human cyclin-dependent kinases by protein phosphatase type 2C alpha and beta 2 isoforms.
10602502 1999 Tob2, a novel anti-proliferative Tob/BTG1 family member, associates with a component of the CCR4 transcriptional regulatory complex capable of binding cyclin-dependent kinases.
10514479 1999 cdk6 can shorten G(1) phase dependent upon the N-terminal INK4 interaction domain.
10499802 1999 Cdk phosphorylation triggers sequential intramolecular interactions that progressively block Rb functions as cells move through G1.
10205165 1999 The p16(INK4a) tumour suppressor protein inhibits alphavbeta3 integrin-mediated cell spreading on vitronectin by blocking PKC-dependent localization of alphavbeta3 to focal contacts.
9751051 1998 Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
9751050 1998 Structural basis for inhibition of the cyclin-dependent kinase Cdk6 by the tumour suppressor p16INK4a.
9667749 1998 Chemical transformation of mouse liver cells results in altered cyclin D-CDK protein complexes.
9482106 1998 Active cdk6 complexes are predominantly nuclear and represent only a minority of the cdk6 in T cells.
9380698 1997 Hypo-phosphorylation of the retinoblastoma protein (pRb) by cyclin D:Cdk4/6 complexes results in active pRb.
9164930 1997 Rapid nuclear translocation and increased activity of cyclin-dependent kinase 6 after T cell activation.
9150368 1997 Interaction between Cdc37 and Cdk4 in human cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8840966 1996 A p18 mutant defective in CDK6 binding in human breast cancer cells.
8741839 1996 Isolation and characterization of p19INK4d, a p16-related inhibitor specific to CDK6 and CDK4.
8114739 1994 Identification of G1 kinase activity for cdk6, a novel cyclin D partner.
8078588 1994 p15INK4B is a potential effector of TGF-beta-induced cell cycle arrest.
8001816 1994 Growth suppression by p18, a p16INK4/MTS1- and p14INK4B/MTS2-related CDK6 inhibitor, correlates with wild-type pRb function.
7882308 1995 Chromosomal mapping of members of the cdc2 family of protein kinases, cdk3, cdk6, PISSLRE, and PITALRE, and a cdk inhibitor, p27Kip1, to regions involved in human cancer.
7759865 1995 Regulation of synthesis and activity of the PLSTIRE protein (cyclin-dependent kinase 6 (cdk6)), a major cyclin D-associated cdk4 homologue in normal human T lymphocytes.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
1639063 1992 A family of human cdc2-related protein kinases.