Property Summary

Ligand Count 203
NCBI Gene PubMed Count 241
PubMed Score 390.15
PubTator Score 374.93

Knowledge Summary

Patent (29,832)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Microcephaly 166 0.0 4.0
Disease Target Count Z-score Confidence
Cancer 2499 5.739 2.9

Expression

  Differential Expression (27)

Disease log2 FC p
Rheumatoid arthritis 1.500 7.8e-03
glioblastoma 1.800 2.9e-04
acute myeloid leukemia 1.100 2.8e-02
adrenocortical adenoma 1.204 6.4e-03
adult high grade glioma 1.700 4.4e-04
Astrocytoma, Pilocytic 1.800 1.7e-05
atypical teratoid / rhabdoid tumor 2.300 2.2e-04
Breast cancer -1.400 2.7e-04
cystic fibrosis -1.707 4.3e-06
ependymoma 1.400 8.7e-03
group 3 medulloblastoma 1.700 2.2e-04
intraductal papillary-mucinous adenoma (... 1.700 6.9e-03
intraductal papillary-mucinous carcinoma... 1.800 3.0e-02
invasive ductal carcinoma -1.100 2.5e-02
lung adenocarcinoma -1.100 1.5e-04
lung cancer 2.700 3.1e-05
lung carcinoma 1.100 2.5e-11
medulloblastoma, large-cell 2.500 3.1e-04
osteosarcoma 1.747 2.5e-02
ovarian cancer -1.700 4.6e-05
pancreatic cancer 1.500 6.0e-03
primary pancreatic ductal adenocarcinoma 1.324 5.2e-03
primitive neuroectodermal tumor 1.400 8.9e-03
psoriasis -1.100 2.3e-06
sarcoidosis 1.200 7.6e-03
tuberculosis 1.200 2.2e-08
urothelial carcinoma -1.300 6.0e-04

PDB (16)

Gene RIF (170)

AA Sequence

MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLET      1 - 70
FEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHR     71 - 140
VVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFA    141 - 210
EMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKC    211 - 280
LTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA                            281 - 326
//

Text Mined References (255)

PMID Year Title