Property Summary

NCBI Gene PubMed Count 39
PubMed Score 22.64
PubTator Score 45.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma 1.400 9.4e-04
group 3 medulloblastoma 1.100 3.2e-03
intraductal papillary-mucinous adenoma (... 1.300 4.7e-04
lung adenocarcinoma 1.100 9.3e-05
oligodendroglioma 1.100 4.6e-03
osteosarcoma -1.681 6.4e-07
ovarian cancer -1.200 2.0e-05
pancreatic ductal adenocarcinoma liver m... 1.179 3.0e-02
Pick disease -1.300 2.5e-04
progressive supranuclear palsy -1.300 4.9e-03

Gene RIF (17)

AA Sequence

MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLR      1 - 70
ILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQ     71 - 140
QEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQA    141 - 210
SVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEG    211 - 280
TDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETR    281 - 350
NQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHL    351 - 420
FMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADI    421 - 490
SKRYSGRPVNLMGTSL                                                          491 - 506
//

Text Mined References (44)

PMID Year Title