Property Summary

NCBI Gene PubMed Count 245
PubMed Score 1184.79
PubTator Score 542.82

Knowledge Summary

Patent (42,088)

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -1.300 6.1e-06
astrocytoma -1.500 2.0e-02
ependymoma -1.700 8.0e-03
oligodendroglioma -1.200 1.6e-02
atypical teratoid / rhabdoid tumor -1.600 3.3e-09
glioblastoma -1.300 1.8e-04
medulloblastoma -1.300 1.3e-04
medulloblastoma, large-cell -1.300 5.9e-04
tuberculosis 1.500 1.5e-07
colon cancer 1.200 4.4e-02
lung cancer 1.800 6.6e-05
adult high grade glioma -1.500 6.6e-05
pilocytic astrocytoma -1.700 4.5e-08
lung carcinoma 1.100 4.3e-20
Pick disease -1.100 1.0e-02
Breast cancer 1.500 9.4e-21
invasive ductal carcinoma 1.400 3.5e-03

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
504938 other 3 / 0 / 0 Late stage assay provider counterscreen results from the probe development effort to identify non-agonists of the peroxisome proliferator-activated receptor gamma (PPARg): chemiluminescence-based biochemical western blot assay for inhibitors of phosphorylation of PPARG protein levels
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (153)

PMID Text
26966064 These results for the first time demonstrate a role of Cdk5/p35 in the regulation of cell cycle progression modulated by TGF-beta1.
26930193 Data show that cyclin-dependent kinase 5 (Cdk5) could phosphorylate the adjacent S1627 in the leucine-rich repeat kinase 2 (LRRK2) R1628P mutant.
26860827 High cyclin-dependent kinase 5 expression is associated with non-small cell lung cancer and small cell lung cancer.
26698249 A cyclin I-Cdk5 complex forms a critical antiapoptotic factor in the process of generating cisplatin resistance in cervical cancer.
26690371 A novel role of STAT3/miR-21 axis and CDK5/CDK5R1 (p35) in metastasis of head and neck squamous cell carcinoma.
26558783 Nuclear Cdk5 is involved in the regulation of activity-dependent gene transcription and dendritic growth.
26555036 These data identify a novel oncogenic mechanism where CDK5 activation induces CRMP2A phosphorylation in the nuclei of tumour cells
26469698 These p35 mutations are unlikely to cause mental retardation.
26339373 Increased expression of CDK5 infers poor outcomes for nasopharyngeal carcinoma patients.
26317805 Results reveal a link between p25 and BACE1 in Alzheimer disease (AD) brains and suggest that upregulated Cdk5 activation by p25 accelerates AD pathogenesis by enhancing BACE1 activity via phosphorylation.
26268594 LRRK2 facilitates tau phosphorylation indirectly by recruiting tau or cdk5 rather than by directly phosphorylating tau
26206584 These data show that cell cycle-dependent mechanisms can control ciliary length through a CDK5-FBW7-NDE1 pathway.
26206088 Cdk5-mediated phosphorylation of CHIP negatively regulates its neuroprotective function, thereby contributing to neuronal cell death progression following neurotoxic stimuli.
26205145 High CDK5 expression is correlated with glioma.
26057048 In the postmortem brains of subjects with major depression, CDK5 activity was elevated in Brodmann's area 25, but not in entire prefrontal cortex and hippocampus.
26027726 Cdk5 regulates lymphatic vessel formation and function via phosphorylation of Foxc2.
26018459 Functional inhibition of CDK5 using roscovitine and siRNA markedly suppressed the proliferation of A549 cells and resulted in a reduced tumor mass in vivo.
25931518 Data indicate that combining the CDK inhibitor dinaciclib with the pan-AKT inhibitor MK-2206 showed promising therapeutic results in pancreatic cancer murine model.
25928429 The Cdk5-AMT signal pathway involved in regulation of DDR by TIGAR.
25851605 CDK5 acts as a crucial signaling hub in prostate cancer cells by controlling androgen responses through AR, maintaining and accelerating cell proliferation through AKT activation, and releasing cell cycle breaks.
25829494 CDK5 activity provides resistance to heat-induced apoptosis through the expression of miR-23a and subsequent suppression of NOXA synthesis
25760044 HIV-1 Tat hyperactivates CDK5 by interfering with it's nucleo-cytoplasmic translocation in neuronal cells
25660209 we introduce Cdk5 as a novel drugable target for HCC treatment and suggest the combination of Cdk5 inhibition and DNA damaging agents as a novel therapeutic approach.
25609066 low CDK5 expression is associated with poor overall survival in patients with gastric cancer, and nuclear accumulation of CDK5 inhibits the proliferation and tumorigenicity of human gastric cancer cells.
25572400 Data indicate that familial prion protein (PrP) mutants are equally and efficiently phosphorylated by cyclin-dependent kinase 5 (Cdk5).
25560765 A loss-of-function of the mutant CDK5 gene product is associated with lissencephaly with cerebellar hypoplasia.
25533468 Phosphorylation of synaptic GTPase-activating protein (synGAP) by Ca2+/calmodulin-dependent protein kinase II (CaMKII) and cyclin-dependent kinase 5 (CDK5) alters the ratio of its GAP activity toward Ras and Rap GTPases.
25452387 The CDK5 kinase phosphorylates four serines in DLC1 located N-terminal to the Rho-GAP domain.
25346443 Identify a novel role for Cdk5 in eosinophil mediator release by agonist-induced degranulation.
25189171 Cdk5-mediated phosphorylation of RapGEF2 controls neuronal migration in the developing cerebral cortex.
24917152 The Cdk5-mediated phosphorylation of EFhd2 affected its calcium binding activity.
24851929 Results indicate that cyclin-dependent kinase 5 (Cdk5) activation is important to all-trans retinoic acid (ATRA)-induced cell cycle arrest.
24607229 Disrupting NR2B-Cdk5 interaction via a small interfering peptide (siP) increases NR2B surface levels, facilitates synaptic transmission, and improves memory formation in vivo.
24447338 HIV-1 Tat hyperactivates CDK5 by interfering with it's nucleo-cytoplasmic translocation in neuronal cells
24362465 CDK1 and 5 short hairpin RNA (shRNA) knockdown diminished Grp78 and XBP-1s upregulation while increasing thapsigargin lethality, arguing for a functional role for CDK1/5 in activation of the cytoprotective IRE1/XBP-1 arm of the unfolded protein response
24235147 The Cdk5-dependent regulation of CLOCK function is mediated by alterations of its stability and subcellular distribution.
24135281 Cdk5 signaling via Rb is critical to medullary thyroid carcinoma tumorigenesis and progression
24121667 CDK5 is essential for TGF-beta1-induced epithelial-mesenchymal transition and breast cancer progression.
24098701 Targeting p35/Cdk5 signalling via CIP-peptide promotes angiogenesis in hypoxia.
24091658 Phosphorylated-FAKSer732 was barely detectable during interphase while its levels strongly increased in mitotic cells upon activation of the EGFR/MEK/ERK/CDK5 axis in an integrin-independent manner.
24085300 Structural basis for the different stability and activity between the Cdk5 complexes with p35 and p39 activators.
23955241 HIV-1 Tat hyperactivates CDK5 by interfering with it's nucleo-cytoplasmic translocation in neuronal cells
23941877 Data suggest that in prostate cancer cells CDK5 regulates interaction of STAT3 (signal transducer and activator of transcription 3) with AR (androgen receptor) through phosphorylation of Ser727-STAT3 and thereby up-regulates AR protein stability.
23728742 study demonstrates that HSPB1 mutations induce hyperphosphorylation of neurofilaments (NFs)through Cdk5 and reduce anterograde transport of NFs
23543736 UCH-L1 physically interacts with CDK1, CDK4, and CDK5, enhancing their kinase activity.
23401660 Cdk5 activity promotes stability of E-cadherin-based cell-cell junctions and inhibits the E-cadherin-to-N-cadherin switch typical of epithelial-mesenchymal transitions.
23377270 This study analyzed CDK5 polymorphisms were not associated with the biochemical parameters in patient with Alzheimer's disease.
23362255 Isomerase Pin1 stimulates dephosphorylation of tau protein at cyclin-dependent kinase (Cdk5)-dependent Alzheimer phosphorylation sites
23332172 A significant decrease in the level and activity of cyclin-dependent kinase-5 reduces tau phosphorylation in the brain.
23206597 This review explains how Cdk5 functions as a 'plastic' kinase that maintains the axon growth by enabling efficient cytoskeletal reorganization, protein translation and gene transcription.
22964075 CDK5/munc18-1a functional interaction may lead to dysregulated neurosecretion in schizophrenia CDK5/munc18-1a functional post-mortem prefrontal cortex/Brodmann's area.
22899714 The role of Cdk5 deregulation in cell-cycle-driven Alzheimer disease neuronal death.
22874667 S-nitrosylation pathway wherein Cdk5/NOS1 interaction enhances S-nitrosylation of Cdk5, mediates mitochondrial dysfunction and synaptic loss during the ABETA etiology of Alzheimer's disease.
22833568 Data show that the MEK-ERK pathway regulates cell cycle-related neuronal apoptosis (CRNA) by elevating the levels of cyclin D1, and the increase in cyclin D1 attenuates the activation of cyclin-dependent kinase 5 (cdk5) by its neuronal activator p35.
22829587 Phosphoregulation of the RNA-binding protein Hu antigen R (HuR) by Cdk5 affects centrosome function
22778260 Phosphorylation of gephyrin in hippocampal neurons by cyclin-dependent kinase CDK5 at Ser-270 is dependent on collybistin.
22753194 CDK5-mediated hyperphosphorylation of SIRT1 facilitates development of endothelial senescence and atherosclerosis.
22696682 induction of Cdk5 activity is a novel mechanism through which hASH1 may regulate migration in lung carcinogenesis.
22547140 The results indicate CDK5 as a possible candidate gene for involvement in the development of dyslexia.
22223639 Abeta42 may increase the BACE1 level independently of either Cdk5 or caspase 3 and that Cdk5 inhibition for AD may cause BACE1 elevation, a potentially negative therapeutic outcome.
21924349 novel roles for Cdk5 outside of the nervous system have been proposed, including roles in gene transcription, vesicular transport, apoptosis, cell adhesion, and migration in many cell types and tissues
21922195 suggesting that the enhanced radiation sensitivity of Cdk5(KD) cells is due to a role of Cdk5 in other pathways or the altered polymer levels
21844361 S-nitrosylation of Cdk5 contributes to amyloid-beta (Abeta) peptide-induced dendritic spine loss.
21825040 These results suggest that mutant K-Ras acts in concert with CDK5 and its activators to increase malignant progression, migration, and invasion of pancreatic cancer cells.
21799006 Cdk5 is an important modulator of AR and contributes to prostate cancer growth.
21741478 Cdk5 plays a crucial role in inflammation-induced nociception. (Review)
21712386 a novel role for CDK5 in regulating Kv2.1 channels through direct phosphorylation.
21701498 HtrA2 and Cdk5 interact in human and mouse cell lines and brain.
21671254 CDK5 involvement in tau phosphorylation was confirmed by both the increase in its enzymatic activity and the absence of MT-2 supernatant-mediated neurite retraction when CDK5 was inhibited.
21600237 Cdk5: mediator of neuronal development, death and the response to DNA damage.
21482751 This study confirmed the pivotal role of the cyclin-dependent kinase-like 5 in the pathogenesis of epileptic encephalopathies in infancy and identify early key clinical and electroencephalographic phenotypical features.
21465480 These findings demonstrate the distinct involvement of Cdk5 in GTP- and fMLP-induced secretion by neutrophils, and support the notion that specific targeting of Cdk5 may serve to inhibit the neutrophil secretory process.
21435449 CDK5 activation contributes to the neurodegenerative process in HIV encephalitis via abnormal tau phosphorylation
21415596 Nucleocytoplasmic cyclin-dependent kinase, Cdk5, is involved in neuronal cell cycle and death in post-mitotic neurons.
21335063 Cdk5-dependent phosphorylation of Pctaire1 at Ser95 plays an important role in dendrite development
21289309 CDK5 regulation of proteasome subunit PSMB5 was identified as a probable route to antineoplastic drug sensitization.
21220307 Study reveals a unique role of Cdk5/p35 in activation of the major noncanonical function of EPRS, namely translational control of macrophage inflammatory gene expression.
21209322 High NaCl-induced increase of the overall abundance of TonEBP/OREBP, by itself, eventually raises its effective level in the nucleus, but its rapid CDK5-dependent nuclear localization accelerates the process.
21145489 The proapoptotic function of Noxa in human leukemia cells is regulated by the kinase Cdk5 and by glucose
21044075 In this review, appropriate activity, localization, and regulation of Cdk5 may be critical for long-term survival of neurons, which is more than 80 years in the case of humans.
20826806 Data elucidate Cdk5 as a pivotal new regulator of endothelial cell migration and angiogenesis.
20720012 p5 is a 24-residue peptide, derived from p35, the Cdk5 neuronal activator, specifically inhibits Cdk5-p25 hyperactivity and tau hyperphosphorylation
20673369 cyclin dependent kinase 5 (Cdk5) is one of the kinase studied in neuronal cell system. Recently, the involvement of Cdk5 in phosphorylating p53 has been shown in certain cancer types
20651683 findings strongly suggest that Cdk5-mediated phosphorylation of PPARgamma may be involved in the pathogenesis of insulin-resistance, and present an opportunity for development of an improved generation of anti-diabetic drugs through PPARgamma
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20516069 the cdk5-STAT3 oncogenic pathway plays an important role in the expression of DNA repair genes and that these proteins could be used as predictive markers of tumors that will fail to respond to chemotherapy.
20491486 A second divalent magnesium (Mg2+) ion in addition to the one forming the Mg adenosine triphosphate (MgATP) complex is required to bind to cdk5/p25 for its catalytic activity, suggesting a rate-limiting phosphoryl transfer step.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20357208 CDK5 modulates mineralocorticoid receptor-induced transcriptional activity in a kinase activity-dependent fashion.
20354813 CDK5/p35 may represent a biomarker for prognosis in patients with non-small cell lung cancer
20345761 Cdk5 is an upstream regulator of neurodegenerative pathways triggered by mitogen activated protein kinase p38alpha and a preferable therapeutic target for Alzheimer's Disease
20234188 Cdk5 in the centriolar appendages mediates cenexin1 localization and primary cilia formation.
20213743 Cdk5 can phosphorylate eNOS at the Ser-113 site and down-regulate eNOS-derived nitric oxide levels.
20133653 Conversion of p35 to p25 does not alter the catalytic efficiency of the CDK5 catalytic subunit by using histone H1 or tau as substrates, and that neurotoxicity associated with CDK5/p25 is unlikely attributable to CDK5 hyperactivation.
20013135 Data show that CDK5/p25 complexes were pulled apart by applying external forces with steered molecular dynamics, and suggest a CDK5 activation mechanism by p25.
19960242 The present data indicate a novel target, P2X3 receptors, to express the action of Cdk5 on membrane proteins involved in pain perception.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19822667 Results link Cdk5 to Rho-ROCK signaling via Src and p190RhoGAP and implicate Cdk5 in the regulation of cell contraction, attachment, and migration.
19764350 Cdk5 and p35 might play important roles in retinoic acid-induced HeLa apoptosis
19718565 Observational study of gene-disease association. (HuGE Navigator)
19700222 Activation of transgenic c-Abl by amyloidbeta precursor protein promotes tau phosphorylation through Tyr15 phosphorylation-mediated cyclin-dependent protein kinase 5 (Cdk5) activation.
19693690 CDK5-splicing variant might also be a negative regulator of Wnt/beta-catenin signaling pathway.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19615060 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19615060 Our negative findings in the Spanish population argue against the hypothesis that CDK5 genetic variations are causally related to Alzheimer's disease risk
19514268 Its deregulation causes neuronal death and neurodegenerative diseases. (review)
19514267 plays a role in dopamine signaling and substance addiction. (review)
19514266 regulates insulin secretion of pancreatic beta cells. (review)
19343042 CDK5 promoter polymorphisms contribute to the genetic susceptibility to lung cancer in the Korean population.
19343042 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19050041 Phosphorylation of parkin by casein kinase I and cdk5 decreases parkin solubility, leading to its aggregation and inactivation.
19001851 REVIEW. crucial role of Cdk5 as a cell cycle suppressor in normal post-mitotic neurons; Cdk5 exits the nucleus in neurons risk to death in an AD patient's brain. The shift in sub-cellular location is accompanied by cell cycle re-entry and neuronal death.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18598350 Observational study of gene-disease association. (HuGE Navigator)
18490454 c-Abl and Cdk5 cooperatively regulate maximal activation of p53, resulting in neuronal death in response to oxidative stress by hydrogen peroxide.
18487454 Cdk5 phosphorylates PIKE-A and stimulates its GTPase activity, which activates nuclear Akt and promotes glioblastoma cell migration and invasion.
18480410 Cdk5 may cause Golgi fragmentation upon deregulation in Alzheimer's disease
18460467 relative resistance to phosphatases might be a common feature of Cdk5 substrates and could contribute to the hyperphosphorylation of CRMP2 and Tau observed in Alzheimer disease
18408012 Cdk5 activation in cells that overexpress cyclin G1 leads to c-Myc phosphorylation on Ser-62, which is responsible for cyclin G1-mediated transcriptional activation of cyclin B1.
18350355 In our analysis, the haplotype tagged by the G allele of SNP rs2069442 was significantly associated with AD (p = 0.05). In conclusion, our study suggests that CDK5 may be associated with AD.
18350355 Observational study of gene-disease association. (HuGE Navigator)
18326489 Thr-138 phosphorylation plays a critical role in the control of the p35 functions in microtubule assembly and neurite outgrowth
18247371 HIV-1 Tat hyperactivates CDK5 by interfering with it's nucleo-cytoplasmic translocation in neuronal cells
17713927 Phosphorylation on a conserved Thr14 can inhibit activities of both the kinases, but phosphorylating another conserved Tyr15, however, can lead to totally opposite inhibition and stimulation consequences in CDK2 and CDK5.
17611284 The Cdk5/DNA damage pathway is dysregulated in Huntington's disease.
17581253 Results show that Cdk5, a critical signalling effector of various neurotoxic insults in the brain, is activated by EV71 infection of neuronal cells.
17493033 Increased expression of Cdk5 was seen in stroke-affected tissue, with about a third showing increased p35 and p25 cleaved fragment. Increased Cdk5-, p-Cdk5- and p35-positive neurons and microvessels occurred in stroke-affected regions.
17491008 microtubules play an important role in the control of Cdk5 activation
17145757 Cdk5 kinase supports the proliferation of the medullary thyroid carcinoma cells.
17121855 phosphorylation of Thr(138) predominantly defines the susceptibility of p35 to calpain-dependent cleavage and that dephosphorylation of this site is a critical determinant of Cdk5-p25-induced cell death associated with neurodegeneration
17060323 p35 employs pathways distinct from that used by Cdk5 for transport to the nucleus
17045592 phosphorylation of tau at Thr231 and Ser262 by cdk5 plus GSK-3, which inhibits its normal biological activity, is regulated both by its amino terminal inserts and its physical state
17036052 nestin is a survival determinant whose action is based upon a novel mode of Cdk5 regulation, affecting the targeting, activity, and turnover of the Cdk5/p35 signaling complex
16413130 Mediates exocytosis and decreases beta-amyloid peptide formation in Alzheimer disease.
16407256 molecular analysis of the CDK5/p25 and CDK2/cyclin A systems
16327995 This is the first report of cdk5/p35 expression and kinase activity in colon cancer cells, which is associated with ciglitazone-induced antiproliferation in HT-29 cells
15917097 role of the CDK5 molecular complex in the genetic etiology of early-onset Alzheimer disease; a yet unknown functional variant in CDK5 or in a nearby gene might lead to increased susceptibility for early-onset Alzheimer disease
15911879 These data predict that the ability of cdk5 phosphorylation to protect against htt cleavage, aggregation, and toxicity is compromised in cells expressing toxic fragments of htt.
15741232 an early event in neuronal cell death is p25/Cdk5-mediated retinoblastoma phosphorylation
15492003 data suggest that Cyclin-dependent kinase 5 (Cdk5)-Cdk5 activator p35 is required to elicit the maximum GTP-induced secretory response from neutrophils
15123618 These results suggest that Cdk5/p35 and p25 are novel players in digoxin-triggered prostate cancer cell apoptosis and, therefore, become potential therapeutic targets.
15013773 we show that alpha-chimaerin is a Cdk5p35-binding protein; in transfected HeLa cells, Cdk5p35 and alpha-chimaerin displayed an overlapping distribution pattern
12826674 p25-Cdk5 is responsible for the mitotic-like phosphoepitopes present in neurofibrillary tangles and Cdk5 has a critical role in neurodegenerative mechanisms
12765608 cdk5 can initiate a major impact on tau pathology progression that probably involves several kinases.
12491158 HIV-1 Tat hyperactivates CDK5 by interfering with it's nucleo-cytoplasmic translocation in neuronal cells
12387894 role in phosphorylation of tau protein
12372407 CDK5 binds to roscovitine in the ATP-binding pocket
12071639 This suggests a close, stable intermolecular association between cdk5 and phosphorylated tau, consistent with phosphorylation of tau by cdk5 in AD brain.
11865137 Total cdk5 protein levels are significantly increased in progressive supranuclear palsy brain tissue.
11784720 Our data suggest that neurotoxic insults lead to calpain-mediated conversion of p39 to p29, which might contribute to deregulation of Cdk5

AA Sequence

MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVL      1 - 70
HSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGEL     71 - 140
KLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDD    141 - 210
QLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEA    211 - 280
LQHPYFSDFCPP                                                              281 - 292
//

Text Mined References (271)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26966064 2016 Transforming growth factor-?1 induces cell cycle arrest by activating atypical cyclin-dependent kinase 5 through up-regulation of Smad3-dependent p35 expression in human MCF10A mammary epithelial cells.
26930193 2016 Parkinson-Related LRRK2 Mutation R1628P Enables Cdk5 Phosphorylation of LRRK2 and Upregulates Its Kinase Activity.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26860827 2016 An immunohistochemical study of cyclin-dependent kinase 5 (CDK5) expression in non-small cell lung cancer (NSCLC) and small cell lung cancer (SCLC): a possible prognostic biomarker.
26698249 2015 Cyclin I promotes cisplatin resistance via Cdk5 activation in cervical cancer.
26690371 2015 Targeting STAT3/miR-21 axis inhibits epithelial-mesenchymal transition via regulating CDK5 in head and neck squamous cell carcinoma.
26558783 2015 Cdk5 Regulates Activity-Dependent Gene Expression and Dendrite Development.
26555036 2015 Phosphorylation of a splice variant of collapsin response mediator protein 2 in the nucleus of tumour cells links cyclin dependent kinase-5 to oncogenesis.
26469698 2015 Effects of p35 Mutations Associated with Mental Retardation on the Cellular Function of p35-CDK5.
26339373 2015 Aberrant expression of CDK5 infers poor outcomes for nasopharyngeal carcinoma patients.
26317805 2015 Enhancement of BACE1 Activity by p25/Cdk5-Mediated Phosphorylation in Alzheimer's Disease.
26268594 2015 LRRK2 Facilitates tau Phosphorylation through Strong Interaction with tau and cdk5.
26206584 2015 Cell cycle-dependent ubiquitylation and destruction of NDE1 by CDK5-FBW7 regulates ciliary length.
26206088 2016 Phosphorylation of CHIP at Ser20 by Cdk5 promotes tAIF-mediated neuronal death.
26205145 2015 Insights into the clinical value of cyclin-dependent kinase 5 in glioma: a retrospective study.
26057048 2015 Acute and chronic stress differentially regulate cyclin-dependent kinase 5 in mouse brain: implications to glucocorticoid actions and major depression.
26027726 2015 Cdk5 controls lymphatic vessel development and function by phosphorylation of Foxc2.
26018459 2015 Cyclin-dependent kinase 5 regulates the proliferation, motility and invasiveness of lung cancer cells through its effects on cytoskeletal remodeling.
25931518 2015 Combined Inhibition of Cyclin-Dependent Kinases (Dinaciclib) and AKT (MK-2206) Blocks Pancreatic Tumor Growth and Metastases in Patient-Derived Xenograft Models.
25928429 2015 TIGAR regulates DNA damage and repair through pentosephosphate pathway and Cdk5-ATM pathway.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25851605 2015 Cyclin-dependent kinase 5 acts as a critical determinant of AKT-dependent proliferation and regulates differential gene expression by the androgen receptor in prostate cancer cells.
25829494 2015 Heat shock inhibition of CDK5 increases NOXA levels through miR-23a repression.
25660209 2015 Targeting cyclin dependent kinase 5 in hepatocellular carcinoma--A novel therapeutic approach.
25609066 2015 Cyclin-dependent kinase 5 decreases in gastric cancer and its nuclear accumulation suppresses gastric tumorigenesis.
25572400 2015 Cyclin-dependent kinase 5 phosphorylation of familial prion protein mutants exacerbates conversion into amyloid structure.
25560765 2015 Autosomal recessive lissencephaly with cerebellar hypoplasia is associated with a loss-of-function mutation in CDK5.
25533468 2015 Phosphorylation of synaptic GTPase-activating protein (synGAP) by Ca2+/calmodulin-dependent protein kinase II (CaMKII) and cyclin-dependent kinase 5 (CDK5) alters the ratio of its GAP activity toward Ras and Rap GTPases.
25452387 2014 CDK5 is a major regulator of the tumor suppressor DLC1.
25416956 2014 A proteome-scale map of the human interactome network.
25346443 2015 Cyclin-dependent kinase 5 regulates degranulation in human eosinophils.
25189171 2014 Cdk5-mediated phosphorylation of RapGEF2 controls neuronal migration in the developing cerebral cortex.
24917152 2014 Cdk5 phosphorylation of EFhd2 at S74 affects its calcium binding activity.
24851929 2014 All-trans retinoic acid induces DU145 cell cycle arrest through Cdk5 activation.
24607229 2014 Memory enhancement by targeting Cdk5 regulation of NR2B.
24548080 2014 CDK5 protects from caspase-induced Ataxin-3 cleavage and neurodegeneration.
24362465 2014 Dinaciclib (SCH727965) inhibits the unfolded protein response through a CDK1- and 5-dependent mechanism.
24235147 2013 Cyclin-dependent kinase 5 (Cdk5) regulates the function of CLOCK protein by direct phosphorylation.
24135281 2013 The role of Cdk5 in neuroendocrine thyroid cancer.
24121667 2013 CDK5 is essential for TGF-?1-induced epithelial-mesenchymal transition and breast cancer progression.
24098701 2013 Targeting p35/Cdk5 signalling via CIP-peptide promotes angiogenesis in hypoxia.
24091658 2013 EGFR/MEK/ERK/CDK5-dependent integrin-independent FAK phosphorylated on serine 732 contributes to microtubule depolymerization and mitosis in tumor cells.
24085300 2013 Structural basis for the different stability and activity between the Cdk5 complexes with p35 and p39 activators.
23941877 2013 Cyclin-dependent kinase 5 modulates STAT3 and androgen receptor activation through phosphorylation of Ser?²? on STAT3 in prostate cancer cells.
23728742 2013 Charcot-Marie-Tooth causing HSPB1 mutations increase Cdk5-mediated phosphorylation of neurofilaments.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23543736 2013 Ubiquitin C-terminal hydrolase L1 (UCH-L1) acts as a novel potentiator of cyclin-dependent kinases to enhance cell proliferation independently of its hydrolase activity.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23401660 2013 Cyclin-dependent kinase 5 promotes the stability of corneal epithelial cell junctions.
23377270 2012 Association between plasma biomarkers, CDK5 polymorphism and the risk of Alzheimer's disease.
23362255 2013 Isomerase Pin1 stimulates dephosphorylation of tau protein at cyclin-dependent kinase (Cdk5)-dependent Alzheimer phosphorylation sites.
23332172 2013 5-Lipoxygenase pharmacological blockade decreases tau phosphorylation in vivo: involvement of the cyclin-dependent kinase-5.
23206597 2012 Cyclin-dependent kinase 5 in axon growth and regeneration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22964075 2013 Cyclin-dependent kinase-5 and p35/p25 activators in schizophrenia and major depression prefrontal cortex: basal contents and effects of psychotropic medications.
22899714 2012 Deregulated Cdk5 triggers aberrant activation of cell cycle kinases and phosphatases inducing neuronal death.
22874667 S-nitrosylation of Cdk5: potential implications in amyloid-?-related neurotoxicity in Alzheimer disease.
22833568 2012 Interplay between MEK-ERK signaling, cyclin D1, and cyclin-dependent kinase 5 regulates cell cycle reentry and apoptosis of neurons.
22829587 2012 Phosphoregulation of the RNA-binding protein Hu antigen R (HuR) by Cdk5 affects centrosome function.
22778260 2012 Phosphorylation of gephyrin in hippocampal neurons by cyclin-dependent kinase CDK5 at Ser-270 is dependent on collybistin.
22753194 2012 Cyclin-dependent kinase 5-mediated hyperphosphorylation of sirtuin-1 contributes to the development of endothelial senescence and atherosclerosis.
22745285 2012 Synaptic vesicle pools and dynamics.
22696682 2012 Achaete-scute homologue-1 (ASH1) stimulates migration of lung cancer cells through Cdk5/p35 pathway.
22547140 2012 Association of rs2069459 in the CDK5 gene with dyslexia in a German cohort.
22223639 2012 Cdk5 protein inhibition and A?42 increase BACE1 protein level in primary neurons by a post-transcriptional mechanism: implications of CDK5 as a therapeutic target for Alzheimer disease.
22078880 2011 Adipocyte NCoR knockout decreases PPAR? phosphorylation and enhances PPAR? activity and insulin sensitivity.
21924349 2012 Going out of the brain: non-nervous system physiological and pathological functions of Cdk5.
21922195 2012 The impact of cyclin-dependent kinase 5 depletion on poly(ADP-ribose) polymerase activity and responses to radiation.
21844361 2011 S-Nitrosylation activates Cdk5 and contributes to synaptic spine loss induced by beta-amyloid peptide.
21825040 2011 Cyclin-dependent kinase 5 is amplified and overexpressed in pancreatic cancer and activated by mutant K-Ras.
21799006 2011 Regulation of androgen receptor and prostate cancer growth by cyclin-dependent kinase 5.
21741478 2011 Twice switched at birth: cell cycle-independent roles of the "neuron-specific" cyclin-dependent kinase 5 (Cdk5) in non-neuronal cells.
21712386 2011 Activity-dependent phosphorylation of neuronal Kv2.1 potassium channels by CDK5.
21701498 2012 Phosphorylation of HtrA2 by cyclin-dependent kinase-5 is important for mitochondrial function.
21671254 2011 Inhibition of cyclin-dependent kinase 5 but not of glycogen synthase kinase 3-? prevents neurite retraction and tau hyperphosphorylation caused by secretable products of human T-cell leukemia virus type I-infected lymphocytes.
21668448 2011 Glutathione-S-transferase P1 is a critical regulator of Cdk5 kinase activity.
21600237 2011 Cdk5: mediator of neuronal development, death and the response to DNA damage.
21499257 2011 Cdk5-mediated phosphorylation of endophilin B1 is required for induced autophagy in models of Parkinson's disease.
21482751 2011 Pathogenic role of the X-linked cyclin-dependent kinase-like 5 and aristaless-related homeobox genes in epileptic encephalopathy of unknown etiology with onset in the first year of life.
21473899 2011 Cdk5: multitasking between physiological and pathological conditions.
21465480 2012 Cdk5 mediates vimentin Ser56 phosphorylation during GTP-induced secretion by neutrophils.
21442427 2011 Cdk5 targets active Src for ubiquitin-dependent degradation by phosphorylating Src(S75).
21435449 2011 Increased CDK5 expression in HIV encephalitis contributes to neurodegeneration via tau phosphorylation and is reversed with Roscovitine.
21415596 2011 Nucleocytoplasmic Cdk5 is involved in neuronal cell cycle and death in post-mitotic neurons.
21335063 2011 Cyclin-dependent kinase 5-dependent phosphorylation of Pctaire1 regulates dendrite development.
21289309 2011 RNAi screen of the druggable genome identifies modulators of proteasome inhibitor sensitivity in myeloma including CDK5.
21269460 2011 Initial characterization of the human central proteome.
21220307 2011 Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control.
21209322 2011 High NaCl-induced activation of CDK5 increases phosphorylation of the osmoprotective transcription factor TonEBP/OREBP at threonine 135, which contributes to its rapid nuclear localization.
21145489 2010 The proapoptotic function of Noxa in human leukemia cells is regulated by the kinase Cdk5 and by glucose.
21144757 2011 Design, synthesis, and testing of an 6-O-linked series of benzimidazole based inhibitors of CDK5/p25.
21044075 2010 Regulation and role of cyclin-dependent kinase activity in neuronal survival and death.
20826806 2010 Cyclin-dependent kinase 5 regulates endothelial cell migration and angiogenesis.
20720012 2010 A 24-residue peptide (p5), derived from p35, the Cdk5 neuronal activator, specifically inhibits Cdk5-p25 hyperactivity and tau hyperphosphorylation.
20673369 2010 Cdk5 phosphorylates non-genotoxically overexpressed p53 following inhibition of PP2A to induce cell cycle arrest/apoptosis and inhibits tumor progression.
20651683 2010 Anti-diabetic drugs inhibit obesity-linked phosphorylation of PPARgamma by Cdk5.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20559324 2010 Cables1 protects p63 from proteasomal degradation to ensure deletion of cells after genotoxic stress.
20516069 2010 The cdk5 kinase regulates the STAT3 transcription factor to prevent DNA damage upon topoisomerase I inhibition.
20491486 2010 Kinetic mechanistic studies of Cdk5/p25-catalyzed H1P phosphorylation: metal effect and solvent kinetic isotope effect.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20357208 2010 Cyclin-dependent kinase 5 modulates the transcriptional activity of the mineralocorticoid receptor and regulates expression of brain-derived neurotrophic factor.
20354813 2011 Expression of CDK5/p35 in resected patients with non-small cell lung cancer: relation to prognosis.
20345761 2010 Cdk5 is a major regulator of p38 cascade: relevance to neurotoxicity in Alzheimer's disease.
20234188 2010 Cdk5 in the centriolar appendages mediates cenexin1 localization and primary cilia formation.
20213743 2010 CDK5 phosphorylates eNOS at Ser-113 and regulates NO production.
20133653 2010 No difference in kinetics of tau or histone phosphorylation by CDK5/p25 versus CDK5/p35 in vitro.
20061803 2010 Cdk5, the multifunctional surveyor.
20013135 2010 Mechanism of CDK5 activation revealed by steered molecular dynamics simulations and energy calculations.
19960242 2010 The Cdk5 kinase downregulates ATP-gated ionotropic P2X3 receptor function via serine phosphorylation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19822667 2009 Cdk5-dependent regulation of Rho activity, cytoskeletal contraction, and epithelial cell migration via suppression of Src and p190RhoGAP.
19782409 2009 Making a neuron: Cdk5 in embryonic and adult neurogenesis.
19764350 2009 The role of Cdk5 in retinoic acid-induced apoptosis of cervical cancer cell line.
19718565 2010 Genetic variants of cyclin-dependent kinase 5 regulatory subunit associated protein 1-like 1 and transcription factor 7-like 2 are not associated with polycystic ovary syndrome in Chinese women.
19700222 2011 c-Abl tyrosine kinase modulates tau pathology and Cdk5 phosphorylation in AD transgenic mice.
19693690 2010 Characterization of a novel human CDK5 splicing variant that inhibits Wnt/beta-catenin signaling.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19615060 2009 No association of CDK5 genetic variants with Alzheimer's disease risk.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19514268 2009 [Deregulation of Cdk5 in neuronal death and neurodegenerative diseases].
19514267 2009 [Role of Cdk5 in dopamine signaling and addiction].
19514266 2009 [Functions of Cdk5 in non-neuronal tissues: focusing on regulation of insulin secretion].
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19343042 2009 Single-nucleotide polymorphisms in the promoter of the CDK5 gene and lung cancer risk in a Korean population.
19238148 2009 Cell cycle, CDKs and cancer: a changing paradigm.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19081376 2008 Deregulation of HDAC1 by p25/Cdk5 in neurotoxicity.
19050041 2009 Combined kinase inhibition modulates parkin inactivation.
19001851 2008 Cdk5 and the non-catalytic arrest of the neuronal cell cycle.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18598350 2008 Impact of nine common type 2 diabetes risk polymorphisms in Asian Indian Sikhs: PPARG2 (Pro12Ala), IGF2BP2, TCF7L2 and FTO variants confer a significant risk.
18507738 2008 Myristoylation of p39 and p35 is a determinant of cytoplasmic or nuclear localization of active cyclin-dependent kinase 5 complexes.
18490454 2008 Cooperative roles of c-Abl and Cdk5 in regulation of p53 in response to oxidative stress.
18487454 2008 Cdk5-mediated regulation of the PIKE-A-Akt pathway and glioblastoma cell invasion.
18480410 2008 Novel genetic tools reveal Cdk5's major role in Golgi fragmentation in Alzheimer's disease.
18460467 2008 Relative resistance of Cdk5-phosphorylated CRMP2 to dephosphorylation.
18408012 2008 Cdk5-mediated phosphorylation of c-Myc on Ser-62 is essential in transcriptional activation of cyclin B1 by cyclin G1.
18350355 2008 Cyclin-dependent kinase 5 is associated with risk for Alzheimer's disease in a Dutch population-based study.
18326489 2008 Calmodulin binding and Cdk5 phosphorylation of p35 regulate its effect on microtubules.
18042622 2007 Cdk5 regulates differentiation of oligodendrocyte precursor cells through the direct phosphorylation of paxillin.
17713927 2007 The activation and inhibition of cyclin-dependent kinase-5 by phosphorylation.
17671990 2007 Regulation of membrane association and kinase activity of Cdk5-p35 by phosphorylation of p35.
17611284 2007 Phosphorylation of huntingtin by cyclin-dependent kinase 5 is induced by DNA damage and regulates wild-type and mutant huntingtin toxicity in neurons.
17591690 2007 Stabilization and activation of p53 induced by Cdk5 contributes to neuronal cell death.
17581253 2007 Enterovirus 71 triggering of neuronal apoptosis through activation of Abl-Cdk5 signalling.
17493033 2007 Expression of cyclin-dependent kinase 5 mRNA and protein in the human brain following acute ischemic stroke.
17491008 2007 Microtubule association of the neuronal p35 activator of Cdk5.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17145757 2007 Cdk5 regulates STAT3 activation and cell proliferation in medullary thyroid carcinoma cells.
17143272 2007 Cdk5 regulates EphA4-mediated dendritic spine retraction through an ephexin1-dependent mechanism.
17121855 2007 Suppression of calpain-dependent cleavage of the CDK5 activator p35 to p25 by site-specific phosphorylation.
17060323 2006 Identification of nuclear import mechanisms for the neuronal Cdk5 activator.
17045592 2006 Regulation of phosphorylation of tau by cyclin-dependent kinase 5 and glycogen synthase kinase-3 at substrate level.
17036052 2006 A nestin scaffold links Cdk5/p35 signaling to oxidant-induced cell death.
17009320 2007 cdk5 modulates beta- and delta-catenin/Pin1 interactions in neuronal cells.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16519508 2006 Cyclin-dependent protein kinase 5 primes microtubule-associated protein tau site-specifically for glycogen synthase kinase 3beta.
16413130 2006 Cyclin-dependent kinase 5, Munc18a and Munc18-interacting protein 1/X11alpha protein up-regulation in Alzheimer's disease.
16407256 2006 Different mechanisms of CDK5 and CDK2 activation as revealed by CDK5/p25 and CDK2/cyclin A dynamics.
16327995 2006 CDK5 is a novel regulatory protein in PPARgamma ligand-induced antiproliferation.
16039528 2005 Defining Cdk5 ligand chemical space with small molecule inhibitors of tau phosphorylation.
15992363 2005 Activation of latent cyclin-dependent kinase 5 (Cdk5)-p35 complexes by membrane dissociation.
15917097 Association of cyclin-dependent kinase 5 and neuronal activators p35 and p39 complex in early-onset Alzheimer's disease.
15911879 2005 Cdk5 phosphorylation of huntingtin reduces its cleavage by caspases: implications for mutant huntingtin toxicity.
15890360 2005 Molecular basis for the specificity of p27 toward cyclin-dependent kinases that regulate cell division.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15741232 2005 p25/Cdk5-mediated retinoblastoma phosphorylation is an early event in neuronal cell death.
15689152 2005 Mechanism of CDK5/p25 binding by CDK inhibitors.
15492003 2004 GTP-dependent secretion from neutrophils is regulated by Cdk5.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15178331 2004 Suppression of the caspase cleavage of beta-amyloid precursor protein by its cytoplasmic phosphorylation.
15123618 2004 Involvement of Cdk5/p25 in digoxin-triggered prostate cancer cell apoptosis.
15030318 2004 The T-cell protein tyrosine phosphatase is phosphorylated on Ser-304 by cyclin-dependent protein kinases in mitosis.
15013773 2004 Alpha-chimaerin exists in a functional complex with the Cdk5 kinase in brain.
14741103 2004 Cdk5 phosphorylation of doublecortin ser297 regulates its effect on neuronal migration.
14704270 2004 Regulation of synaptojanin 1 by cyclin-dependent kinase 5 at synapses.
14521924 2003 Apoptosis-associated tyrosine kinase is a Cdk5 activator p35 binding protein.
12972605 2003 Puralpha is essential for postnatal brain development and developmentally coupled cellular proliferation as revealed by genetic inactivation in the mouse.
12963086 2004 Co-purification and localization of Munc18-1 (p67) and Cdk5 with neuronal cytoskeletal proteins.
12855954 2003 Cdk5 is essential for synaptic vesicle endocytosis.
12853948 2003 The DNA sequence of human chromosome 7.
12832492 2003 Cdk5 regulates the organization of Nestin and its association with p35.
12826674 2003 Mitotic-like tau phosphorylation by p25-Cdk5 kinase complex.
12824184 2003 Cyclin-dependent kinase-5 is involved in neuregulin-dependent activation of phosphatidylinositol 3-kinase and Akt activity mediating neuronal survival.
12796778 2003 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome.
12769842 2003 Increased ezrin expression and activation by CDK5 coincident with acquisition of the senescent phenotype.
12765608 2003 Cdk5 is a key factor in tau aggregation and tangle formation in vivo.
12691662 2003 Cdk5-mediated inhibition of the protective effects of transcription factor MEF2 in neurotoxicity-induced apoptosis.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12491158 2002 Tat-induced deregulation of neuronal differentiation and survival by nerve growth factor pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435421 2002 Aberrant glycosylation modulates phosphorylation of tau by protein kinase A and dephosphorylation of tau by protein phosphatase 2A and 5.
12393264 2002 Influence of phosphorylation of p35, an activator of cyclin-dependent kinase 5 (cdk5), on the proteolysis of p35.
12387894 2002 Involvement of aberrant glycosylation in phosphorylation of tau by cdk5 and GSK-3beta.
12372407 2002 Molecular model of cyclin-dependent kinase 5 complexed with roscovitine.
12372285 2002 Fyn and Cdk5 mediate semaphorin-3A signaling, which is involved in regulation of dendrite orientation in cerebral cortex.
12226093 2002 Truncation of CDK5 activator p35 induces intensive phosphorylation of Ser202/Thr205 of human tau.
12223541 2002 The cyclin-dependent kinase 5 activators p35 and p39 interact with the alpha-subunit of Ca2+/calmodulin-dependent protein kinase II and alpha-actinin-1 in a calcium-dependent manner.
12154070 2002 A novel centrosome-associated protein with affinity for microtubules.
12084709 2002 Pctaire1 interacts with p35 and is a novel substrate for Cdk5/p35.
12077184 2002 Cyclin-dependent kinase 5 phosphorylates disabled 1 independently of Reelin signaling.
12064478 2002 Cdk5 phosphorylates p53 and regulates its activity.
12056836 2002 Cyclin-dependent kinase-5/p35 phosphorylates Presenilin 1 to regulate carboxy-terminal fragment stability.
11955625 2002 ik3-2, a relative to ik3-1/cables, is associated with cdk3, cdk5, and c-abl.
11882646 2002 Identification of a neuronal Cdk5 activator-binding protein as Cdk5 inhibitor.
11865137 2002 Increase of cdk5 is related to neurofibrillary pathology in progressive supranuclear palsy.
11823425 2002 Cyclin-dependent kinase 5 prevents neuronal apoptosis by negative regulation of c-Jun N-terminal kinase 3.
11784720 2002 Calpain-mediated cleavage of the cyclin-dependent kinase-5 activator p39 to p29.
11743029 2001 The Cdk5-p35 kinase associates with the Golgi apparatus and regulates membrane traffic.
11741927 2002 The protein SET binds the neuronal Cdk5 activator p35nck5a and modulates Cdk5/p35nck5a activity.
11733001 2001 ik3-1/Cables is a substrate for cyclin-dependent kinase 3 (cdk 3).
11684694 2002 Phosphorylation of MEK1 by cdk5/p35 down-regulates the mitogen-activated protein kinase pathway.
11675505 2001 Regulation of NMDA receptors by cyclin-dependent kinase-5.
11604394 2001 Phosphorylation of Pak1 by the p35/Cdk5 kinase affects neuronal morphology.
11584302 2001 A decade of CDK5.
11583627 2001 Structure and regulation of the CDK5-p25(nck5a) complex.
11483158 2001 Glycogen synthase kinase3 beta phosphorylates serine 33 of p53 and activates p53's transcriptional activity.
11311121 2001 The kinase DYRK phosphorylates protein-synthesis initiation factor eIF2Bepsilon at Ser539 and the microtubule-associated protein tau at Thr212: potential role for DYRK as a glycogen synthase kinase 3-priming kinase.
11278541 2001 Mitotic reorganization of the intermediate filament protein nestin involves phosphorylation by cdc2 kinase.
11254741 2001 Reactivity of anti-proliferating cell nuclear antigen (PCNA) murine monoclonal antibodies and human autoantibodies to the PCNA multiprotein complexes involved in cell proliferation.
11181841 2001 Characterization of the in vitro phosphorylation of human tau by tau protein kinase II (cdk5/p20) using mass spectrometry.
11168528 2001 p35/cdk5 binds and phosphorylates beta-catenin and regulates beta-catenin/presenilin-1 interaction.
11113134 2001 Amphiphysin 1 binds the cyclin-dependent kinase (cdk) 5 regulatory subunit p35 and is phosphorylated by cdk5 and cdc2.
11104762 2001 Phosphorylation of tau is regulated by PKN.
10995546 2000 CROC-4: a novel brain specific transcriptional activator of c-fos expressed from proliferation through to maturation of multiple neuronal cell types.
10936190 2000 Neuron-specific phosphorylation of Alzheimer's beta-amyloid precursor protein by cyclin-dependent kinase 5.
10896159 2000 Cables links Cdk5 and c-Abl and facilitates Cdk5 tyrosine phosphorylation, kinase upregulation, and neurite outgrowth.
10884347 2000 The C-terminal regulatory domain of p53 contains a functional docking site for cyclin A.
10762698 2000 Cdk5 and MAPK are associated with complexes of cytoskeletal proteins in rat brain.
10721722 2000 Cloning of three novel neuronal Cdk5 activator binding proteins.
10683146 2000 p39 activates cdk5 in neurons, and is associated with the actin cytoskeleton.
10604473 1999 Phosphorylation of DARPP-32 by Cdk5 modulates dopamine signalling in neurons.
10604467 1999 Conversion of p35 to p25 deregulates Cdk5 activity and promotes neurodegeneration.
10544291 1999 Neuron-specific Cdk5 kinase is responsible for mitosis-independent phosphorylation of c-Src at Ser75 in human Y79 retinoblastoma cells.
10500146 1999 Regulation of cyclin-dependent kinase 5 catalytic activity by phosphorylation.
9832145 1998 New phosphorylation sites identified in hyperphosphorylated tau (paired helical filament-tau) from Alzheimer's disease brain using nanoelectrospray mass spectrometry.
9822744 1998 Evidence for the participation of the neuron-specific CDK5 activator P35 during laminin-enhanced axonal growth.
9771888 1998 Tau is phosphorylated by GSK-3 at several sites found in Alzheimer disease and its biological activity markedly inhibited only after it is prephosphorylated by A-kinase.
9735171 1998 Phosphorylation of tau at both Thr 231 and Ser 262 is required for maximal inhibition of its binding to microtubules.
9614189 1998 The endogenous and cell cycle-dependent phosphorylation of tau protein in living cells: implications for Alzheimer's disease.
9596352 1998 Cyclin-dependent kinase-5 is associated with lipofuscin in motor neurones in amyotrophic lateral sclerosis.
9565682 1998 Characterization of tau phosphorylation in glycogen synthase kinase-3beta and cyclin dependent kinase-5 activator (p23) transfected cells.
9546672 1998 Sequential phosphorylation of Tau by glycogen synthase kinase-3beta and protein kinase A at Thr212 and Ser214 generates the Alzheimer-specific epitope of antibody AT100 and requires a paired-helical-filament-like conformation.
9478941 1998 Regulation of Munc-18/syntaxin 1A interaction by cyclin-dependent kinase 5 in nerve endings.
9422379 1998 Cyclin D2 interacts with cdk-5 and modulates cellular cdk-5/p35 activity.
9396813 1997 Identification of DNA replication and cell cycle proteins that interact with PCNA.
9353289 1997 Phosphorylation by neuronal cdc2-like protein kinase promotes dimerization of Tau protein in vitro.
9199504 1997 Phosphorylation of microtubule-associated protein tau by stress-activated protein kinases.
9150368 1997 Interaction between Cdc37 and Cdk4 in human cells.
9030781 1997 Biochemical and cellular effects of roscovitine, a potent and selective inhibitor of the cyclin-dependent kinases cdc2, cdk2 and cdk5.
9013862 1997 GAK: a cyclin G associated kinase contains a tensin/auxilin-like domain.
8891282 1996 Intracellular localization of cyclin-dependent kinase 5 (CDK5) in mouse neuron: CDK5 is located in both nucleus and cytoplasm.
8764598 1996 In vitro phosphorylation of the cytoplasmic domain of the amyloid precursor protein by glycogen synthase kinase-3beta.
8702879 1996 Site-specific phosphorylation of synapsin I by mitogen-activated protein kinase and Cdk5 and its effects on physiological functions.
8275715 1994 Chromosomal mapping of human CDK2, CDK4, and CDK5 cell cycle kinase genes.
8090222 1994 A brain-specific activator of cyclin-dependent kinase 5.
8090221 1994 p35 is a neural-specific regulatory subunit of cyclin-dependent kinase 5.
7949095 1994 Association of proliferating cell nuclear antigen with cyclin-dependent kinases and cyclins in normal and transformed human T lymphocytes.
7834371 1994 Expression of CDK5 (PSSALRE kinase), a neural cdc2-related protein kinase, in the mature and developing mouse central and peripheral nervous systems.
7566346 Hyperphosphorylation of tau in PHF.
1639063 1992 A family of human cdc2-related protein kinases.
1330687 1992 p42 MAP kinase phosphorylation sites in microtubule-associated protein tau are dephosphorylated by protein phosphatase 2A1. Implications for Alzheimer's disease [corrected].
1181841 1975 Proceedings: Aneurysmal bone cysts of the spine.