| Tchem | Cyclin-dependent-like kinase 5 |
Proline-directed serine/threonine-protein kinase essential for neuronal cell cycle arrest and differentiation and may be involved in apoptotic cell death in neuronal diseases by triggering abortive cell cycle re-entry. Interacts with D1 and D3-type G1 cyclins. Phosphorylates SRC, NOS3, VIM/vimentin, p35/CDK5R1, MEF2A, SIPA1L1, SH3GLB1, PXN, PAK1, MCAM/MUC18, SEPT5, SYN1, DNM1, AMPH, SYNJ1, CDK16, RAC1, RHOA, CDC42, TONEBP/NFAT5, MAPT/TAU, MAP1B, histone H1, p53/TP53, HDAC1, APEX1, PTK2/FAK1, huntingtin/HTT, ATM, MAP2, NEFH and NEFM. Regulates several neuronal development and physiological processes including neuronal survival, migration and differentiation, axonal and neurite growth, synaptogenesis, oligodendrocyte differentiation, synaptic plasticity and neurotransmission, by phosphorylating key proteins. Activated by interaction with CDK5R1 (p35) and CDK5R2 (p39), especially in post-mitotic neurons, and promotes CDK5R1 (p35) expression in an autostimulation loop. Phosphorylates many downstream substrates such as Rho and Ras family small GTPases (e.g. PAK1, RAC1, RHOA, CDC42) or microtubule-binding proteins (e.g. MAPT/TAU, MAP2, MAP1B), and modulates actin dynamics to regulate neurite growth and/or spine morphogenesis. Phosphorylates also exocytosis associated proteins such as MCAM/MUC18, SEPT5, SYN1, and CDK16/PCTAIRE1 as well as endocytosis associated proteins such as DNM1, AMPH and SYNJ1 at synaptic terminals. In the mature central nervous system (CNS), regulates neurotransmitter movements by phosphorylating substrates associated with neurotransmitter release and synapse plasticity; synaptic vesicle exocytosis, vesicles fusion with the presynaptic membrane, and endocytosis. Promotes cell survival by activating anti-apoptotic proteins BCL2 and STAT3, and negatively regulating of JNK3/MAPK10 activity. Phosphorylation of p53/TP53 in response to genotoxic and oxidative stresses enhances its stabilization by preventing ubiquitin ligase-mediated proteasomal degradation, and induces transactivation of p53/TP53 target genes, thus regulating apoptosis. Phosphorylation of p35/CDK5R1 enhances its stabilization by preventing calpain-mediated proteolysis producing p25/CDK5R1 and avoiding ubiquitin ligase-mediated proteasomal degradation. During aberrant cell-cycle activity and DNA damage, p25/CDK5 activity elicits cell-cycle activity and double-strand DNA breaks that precedes neuronal death by deregulating HDAC1. DNA damage triggered phosphorylation of huntingtin/HTT in nuclei of neurons protects neurons against polyglutamine expansion as well as DNA damage mediated toxicity. Phosphorylation of PXN reduces its interaction with PTK2/FAK1 in matrix-cell focal adhesions (MCFA) during oligodendrocytes (OLs) differentiation. Negative regulator of Wnt/beta-catenin signaling pathway. Activator of the GAIT (IFN-gamma-activated inhibitor of translation) pathway, which suppresses expression of a post-transcriptional regulon of proinflammatory genes in myeloid cells; phosphorylates the linker domain of glutamyl-prolyl tRNA synthetase (EPRS) in a IFN-gamma-dependent manner, the initial event in assembly of the GAIT complex. Phosphorylation of SH3GLB1 is required for autophagy induction in starved neurons. Phosphorylation of TONEBP/NFAT5 in response to osmotic stress mediates its rapid nuclear localization. MEF2 is inactivated by phosphorylation in nucleus in response to neurotoxin, thus leading to neuronal apoptosis. APEX1 AP-endodeoxyribonuclease is repressed by phosphorylation, resulting in accumulation of DNA damage and contributing to neuronal death. NOS3 phosphorylation down regulates NOS3-derived nitrite (NO) levels. SRC phosphorylation mediates its ubiquitin-dependent degradation and thus leads to cytoskeletal reorganization. May regulate endothelial cell migration and angiogenesis via the modulation of lamellipodia formation. Involved in dendritic spine morphogenesis by mediating the EFNA1-EPHA4 signaling. The complex p35/CDK5 participates in the regulation of the circadian clock by modulating the function of CLOCK protein: phosphorylates CLOCK at 'Thr-451' and 'Thr-461' and regulates the transcriptional activity of the CLOCK-ARNTL/BMAL1 heterodimer in association with altered stability and subcellular distribution.
This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]
This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2015]
Comments
| Disease | Target Count |
|---|---|
| Peripheral Neuropathy | 303 |
| Disease | Target Count | P-value |
|---|---|---|
| Breast cancer | 3098 | 9.4e-21 |
| lung carcinoma | 2844 | 4.3e-20 |
| atypical teratoid / rhabdoid tumor | 4369 | 3.3e-09 |
| pilocytic astrocytoma | 3086 | 4.5e-08 |
| tuberculosis | 1563 | 1.5e-07 |
| malignant mesothelioma | 3163 | 6.1e-06 |
| lung cancer | 4473 | 6.6e-05 |
| adult high grade glioma | 2148 | 6.6e-05 |
| medulloblastoma | 1524 | 1.3e-04 |
| glioblastoma | 5572 | 1.8e-04 |
| medulloblastoma, large-cell | 6234 | 5.9e-04 |
| invasive ductal carcinoma | 2950 | 3.5e-03 |
| ependymoma | 2514 | 8.0e-03 |
| Pick disease | 1893 | 1.0e-02 |
| oligodendroglioma | 2849 | 1.6e-02 |
| astrocytoma | 1493 | 2.0e-02 |
| colon cancer | 1475 | 4.4e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Lissencephaly | 61 | 3.697 | 1.8 |
| Neurodegenerative disease | 383 | 0.0 | 4.0 |
| Disease | Target Count |
|---|---|
| Lissencephaly 7 with cerebellar hypoplasia | 1 |
| Disease | Target Count |
|---|---|
| Lissencephaly 7, with cerebellar hypoplasia | 1 |
| Disease | log2 FC | p |
|---|---|---|
| malignant mesothelioma | -1.300 | 6.1e-06 |
| astrocytoma | -1.500 | 2.0e-02 |
| ependymoma | -1.700 | 8.0e-03 |
| oligodendroglioma | -1.200 | 1.6e-02 |
| atypical teratoid / rhabdoid tumor | -1.600 | 3.3e-09 |
| glioblastoma | -1.300 | 1.8e-04 |
| medulloblastoma | -1.300 | 1.3e-04 |
| medulloblastoma, large-cell | -1.300 | 5.9e-04 |
| tuberculosis | 1.500 | 1.5e-07 |
| colon cancer | 1.200 | 4.4e-02 |
| lung cancer | 1.800 | 6.6e-05 |
| adult high grade glioma | -1.500 | 6.6e-05 |
| pilocytic astrocytoma | -1.700 | 4.5e-08 |
| lung carcinoma | 1.100 | 4.3e-20 |
| Pick disease | -1.100 | 1.0e-02 |
| Breast cancer | 1.500 | 9.4e-21 |
| invasive ductal carcinoma | 1.400 | 3.5e-03 |
CHEMBL365855
pIC50 7.60
CHEMBL3775677
pIC50 7.68
CHEMBL3775608
pIC50 7.77
CHEMBL186240
pIC50 7.80
CHEMBL187903
pIC50 7.89
CHEMBL184404
pIC50 7.89
CHEMBL187256
pIC50 7.89
CHEMBL191003
pIC50 7.90
CHEMBL186470
pIC50 7.92
CHEMBL363954
pIC50 8.00
CHEMBL3774932
pIC50 8.05
CHEMBL3775470
pIC50 8.10
CHEMBL364213
pIC50 8.10
CHEMBL384304
pKd 8.13
CHEMBL186898
pIC50 8.16
CHEMBL23254
pIC50 8.22
CHEMBL3775509
pIC50 8.30
CHEMBL3774632
pIC50 8.30
CHEMBL362560
pIC50 8.30
CHEMBL1241758
pIC50 8.30
| AID | Type | Active / Inconclusive / Inactive | Description |
|---|---|---|---|
| 1982 | other |
0 / 0 / 0 | Kinase inhibition selectivity assay for compound SID-48409448 |
| 504938 | other |
3 / 0 / 0 | Late stage assay provider counterscreen results from the probe development effort to identify non-agonists of the peroxisome proliferator-activated receptor gamma (PPARg): chemiluminescence-based biochemical western blot assay for inhibitors of phosphorylation of PPARG protein levels |
| 588725 | other |
0 / 0 / 1 | Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases |
| PMID | Text | |
|---|---|---|
| 26966064 | These results for the first time demonstrate a role of Cdk5/p35 in the regulation of cell cycle progression modulated by TGF-beta1. | |
| 26930193 | Data show that cyclin-dependent kinase 5 (Cdk5) could phosphorylate the adjacent S1627 in the leucine-rich repeat kinase 2 (LRRK2) R1628P mutant. | |
| 26860827 | High cyclin-dependent kinase 5 expression is associated with non-small cell lung cancer and small cell lung cancer. | |
| 26698249 | A cyclin I-Cdk5 complex forms a critical antiapoptotic factor in the process of generating cisplatin resistance in cervical cancer. | |
| 26690371 | A novel role of STAT3/miR-21 axis and CDK5/CDK5R1 (p35) in metastasis of head and neck squamous cell carcinoma. | |
| 26558783 | Nuclear Cdk5 is involved in the regulation of activity-dependent gene transcription and dendritic growth. | |
| 26555036 | These data identify a novel oncogenic mechanism where CDK5 activation induces CRMP2A phosphorylation in the nuclei of tumour cells | |
| 26469698 | These p35 mutations are unlikely to cause mental retardation. | |
| 26339373 | Increased expression of CDK5 infers poor outcomes for nasopharyngeal carcinoma patients. | |
| 26317805 | Results reveal a link between p25 and BACE1 in Alzheimer disease (AD) brains and suggest that upregulated Cdk5 activation by p25 accelerates AD pathogenesis by enhancing BACE1 activity via phosphorylation. | |
| 26268594 | LRRK2 facilitates tau phosphorylation indirectly by recruiting tau or cdk5 rather than by directly phosphorylating tau | |
| 26206584 | These data show that cell cycle-dependent mechanisms can control ciliary length through a CDK5-FBW7-NDE1 pathway. | |
| 26206088 | Cdk5-mediated phosphorylation of CHIP negatively regulates its neuroprotective function, thereby contributing to neuronal cell death progression following neurotoxic stimuli. | |
| 26205145 | High CDK5 expression is correlated with glioma. | |
| 26057048 | In the postmortem brains of subjects with major depression, CDK5 activity was elevated in Brodmann's area 25, but not in entire prefrontal cortex and hippocampus. | |
| 26027726 | Cdk5 regulates lymphatic vessel formation and function via phosphorylation of Foxc2. | |
| 26018459 | Functional inhibition of CDK5 using roscovitine and siRNA markedly suppressed the proliferation of A549 cells and resulted in a reduced tumor mass in vivo. | |
| 25931518 | Data indicate that combining the CDK inhibitor dinaciclib with the pan-AKT inhibitor MK-2206 showed promising therapeutic results in pancreatic cancer murine model. | |
| 25928429 | The Cdk5-AMT signal pathway involved in regulation of DDR by TIGAR. | |
| 25851605 | CDK5 acts as a crucial signaling hub in prostate cancer cells by controlling androgen responses through AR, maintaining and accelerating cell proliferation through AKT activation, and releasing cell cycle breaks. | |
| 25829494 | CDK5 activity provides resistance to heat-induced apoptosis through the expression of miR-23a and subsequent suppression of NOXA synthesis | |
| 25760044 | HIV-1 Tat hyperactivates CDK5 by interfering with it's nucleo-cytoplasmic translocation in neuronal cells | |
| 25660209 | we introduce Cdk5 as a novel drugable target for HCC treatment and suggest the combination of Cdk5 inhibition and DNA damaging agents as a novel therapeutic approach. | |
| 25609066 | low CDK5 expression is associated with poor overall survival in patients with gastric cancer, and nuclear accumulation of CDK5 inhibits the proliferation and tumorigenicity of human gastric cancer cells. | |
| 25572400 | Data indicate that familial prion protein (PrP) mutants are equally and efficiently phosphorylated by cyclin-dependent kinase 5 (Cdk5). | |
| 25560765 | A loss-of-function of the mutant CDK5 gene product is associated with lissencephaly with cerebellar hypoplasia. | |
| 25533468 | Phosphorylation of synaptic GTPase-activating protein (synGAP) by Ca2+/calmodulin-dependent protein kinase II (CaMKII) and cyclin-dependent kinase 5 (CDK5) alters the ratio of its GAP activity toward Ras and Rap GTPases. | |
| 25452387 | The CDK5 kinase phosphorylates four serines in DLC1 located N-terminal to the Rho-GAP domain. | |
| 25346443 | Identify a novel role for Cdk5 in eosinophil mediator release by agonist-induced degranulation. | |
| 25189171 | Cdk5-mediated phosphorylation of RapGEF2 controls neuronal migration in the developing cerebral cortex. | |
| 24917152 | The Cdk5-mediated phosphorylation of EFhd2 affected its calcium binding activity. | |
| 24851929 | Results indicate that cyclin-dependent kinase 5 (Cdk5) activation is important to all-trans retinoic acid (ATRA)-induced cell cycle arrest. | |
| 24607229 | Disrupting NR2B-Cdk5 interaction via a small interfering peptide (siP) increases NR2B surface levels, facilitates synaptic transmission, and improves memory formation in vivo. | |
| 24447338 | HIV-1 Tat hyperactivates CDK5 by interfering with it's nucleo-cytoplasmic translocation in neuronal cells | |
| 24362465 | CDK1 and 5 short hairpin RNA (shRNA) knockdown diminished Grp78 and XBP-1s upregulation while increasing thapsigargin lethality, arguing for a functional role for CDK1/5 in activation of the cytoprotective IRE1/XBP-1 arm of the unfolded protein response | |
| 24235147 | The Cdk5-dependent regulation of CLOCK function is mediated by alterations of its stability and subcellular distribution. | |
| 24135281 | Cdk5 signaling via Rb is critical to medullary thyroid carcinoma tumorigenesis and progression | |
| 24121667 | CDK5 is essential for TGF-beta1-induced epithelial-mesenchymal transition and breast cancer progression. | |
| 24098701 | Targeting p35/Cdk5 signalling via CIP-peptide promotes angiogenesis in hypoxia. | |
| 24091658 | Phosphorylated-FAKSer732 was barely detectable during interphase while its levels strongly increased in mitotic cells upon activation of the EGFR/MEK/ERK/CDK5 axis in an integrin-independent manner. | |
| 24085300 | Structural basis for the different stability and activity between the Cdk5 complexes with p35 and p39 activators. | |
| 23955241 | HIV-1 Tat hyperactivates CDK5 by interfering with it's nucleo-cytoplasmic translocation in neuronal cells | |
| 23941877 | Data suggest that in prostate cancer cells CDK5 regulates interaction of STAT3 (signal transducer and activator of transcription 3) with AR (androgen receptor) through phosphorylation of Ser727-STAT3 and thereby up-regulates AR protein stability. | |
| 23728742 | study demonstrates that HSPB1 mutations induce hyperphosphorylation of neurofilaments (NFs)through Cdk5 and reduce anterograde transport of NFs | |
| 23543736 | UCH-L1 physically interacts with CDK1, CDK4, and CDK5, enhancing their kinase activity. | |
| 23401660 | Cdk5 activity promotes stability of E-cadherin-based cell-cell junctions and inhibits the E-cadherin-to-N-cadherin switch typical of epithelial-mesenchymal transitions. | |
| 23377270 | This study analyzed CDK5 polymorphisms were not associated with the biochemical parameters in patient with Alzheimer's disease. | |
| 23362255 | Isomerase Pin1 stimulates dephosphorylation of tau protein at cyclin-dependent kinase (Cdk5)-dependent Alzheimer phosphorylation sites | |
| 23332172 | A significant decrease in the level and activity of cyclin-dependent kinase-5 reduces tau phosphorylation in the brain. | |
| 23206597 | This review explains how Cdk5 functions as a 'plastic' kinase that maintains the axon growth by enabling efficient cytoskeletal reorganization, protein translation and gene transcription. | |
| 22964075 | CDK5/munc18-1a functional interaction may lead to dysregulated neurosecretion in schizophrenia CDK5/munc18-1a functional post-mortem prefrontal cortex/Brodmann's area. | |
| 22899714 | The role of Cdk5 deregulation in cell-cycle-driven Alzheimer disease neuronal death. | |
| 22874667 | S-nitrosylation pathway wherein Cdk5/NOS1 interaction enhances S-nitrosylation of Cdk5, mediates mitochondrial dysfunction and synaptic loss during the ABETA etiology of Alzheimer's disease. | |
| 22833568 | Data show that the MEK-ERK pathway regulates cell cycle-related neuronal apoptosis (CRNA) by elevating the levels of cyclin D1, and the increase in cyclin D1 attenuates the activation of cyclin-dependent kinase 5 (cdk5) by its neuronal activator p35. | |
| 22829587 | Phosphoregulation of the RNA-binding protein Hu antigen R (HuR) by Cdk5 affects centrosome function | |
| 22778260 | Phosphorylation of gephyrin in hippocampal neurons by cyclin-dependent kinase CDK5 at Ser-270 is dependent on collybistin. | |
| 22753194 | CDK5-mediated hyperphosphorylation of SIRT1 facilitates development of endothelial senescence and atherosclerosis. | |
| 22696682 | induction of Cdk5 activity is a novel mechanism through which hASH1 may regulate migration in lung carcinogenesis. | |
| 22547140 | The results indicate CDK5 as a possible candidate gene for involvement in the development of dyslexia. | |
| 22223639 | Abeta42 may increase the BACE1 level independently of either Cdk5 or caspase 3 and that Cdk5 inhibition for AD may cause BACE1 elevation, a potentially negative therapeutic outcome. | |
| 21924349 | novel roles for Cdk5 outside of the nervous system have been proposed, including roles in gene transcription, vesicular transport, apoptosis, cell adhesion, and migration in many cell types and tissues | |
| 21922195 | suggesting that the enhanced radiation sensitivity of Cdk5(KD) cells is due to a role of Cdk5 in other pathways or the altered polymer levels | |
| 21844361 | S-nitrosylation of Cdk5 contributes to amyloid-beta (Abeta) peptide-induced dendritic spine loss. | |
| 21825040 | These results suggest that mutant K-Ras acts in concert with CDK5 and its activators to increase malignant progression, migration, and invasion of pancreatic cancer cells. | |
| 21799006 | Cdk5 is an important modulator of AR and contributes to prostate cancer growth. | |
| 21741478 | Cdk5 plays a crucial role in inflammation-induced nociception. (Review) | |
| 21712386 | a novel role for CDK5 in regulating Kv2.1 channels through direct phosphorylation. | |
| 21701498 | HtrA2 and Cdk5 interact in human and mouse cell lines and brain. | |
| 21671254 | CDK5 involvement in tau phosphorylation was confirmed by both the increase in its enzymatic activity and the absence of MT-2 supernatant-mediated neurite retraction when CDK5 was inhibited. | |
| 21600237 | Cdk5: mediator of neuronal development, death and the response to DNA damage. | |
| 21482751 | This study confirmed the pivotal role of the cyclin-dependent kinase-like 5 in the pathogenesis of epileptic encephalopathies in infancy and identify early key clinical and electroencephalographic phenotypical features. | |
| 21465480 | These findings demonstrate the distinct involvement of Cdk5 in GTP- and fMLP-induced secretion by neutrophils, and support the notion that specific targeting of Cdk5 may serve to inhibit the neutrophil secretory process. | |
| 21435449 | CDK5 activation contributes to the neurodegenerative process in HIV encephalitis via abnormal tau phosphorylation | |
| 21415596 | Nucleocytoplasmic cyclin-dependent kinase, Cdk5, is involved in neuronal cell cycle and death in post-mitotic neurons. | |
| 21335063 | Cdk5-dependent phosphorylation of Pctaire1 at Ser95 plays an important role in dendrite development | |
| 21289309 | CDK5 regulation of proteasome subunit PSMB5 was identified as a probable route to antineoplastic drug sensitization. | |
| 21220307 | Study reveals a unique role of Cdk5/p35 in activation of the major noncanonical function of EPRS, namely translational control of macrophage inflammatory gene expression. | |
| 21209322 | High NaCl-induced increase of the overall abundance of TonEBP/OREBP, by itself, eventually raises its effective level in the nucleus, but its rapid CDK5-dependent nuclear localization accelerates the process. | |
| 21145489 | The proapoptotic function of Noxa in human leukemia cells is regulated by the kinase Cdk5 and by glucose | |
| 21044075 | In this review, appropriate activity, localization, and regulation of Cdk5 may be critical for long-term survival of neurons, which is more than 80 years in the case of humans. | |
| 20826806 | Data elucidate Cdk5 as a pivotal new regulator of endothelial cell migration and angiogenesis. | |
| 20720012 | p5 is a 24-residue peptide, derived from p35, the Cdk5 neuronal activator, specifically inhibits Cdk5-p25 hyperactivity and tau hyperphosphorylation | |
| 20673369 | cyclin dependent kinase 5 (Cdk5) is one of the kinase studied in neuronal cell system. Recently, the involvement of Cdk5 in phosphorylating p53 has been shown in certain cancer types | |
| 20651683 | findings strongly suggest that Cdk5-mediated phosphorylation of PPARgamma may be involved in the pathogenesis of insulin-resistance, and present an opportunity for development of an improved generation of anti-diabetic drugs through PPARgamma | |
| 20628086 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 20516069 | the cdk5-STAT3 oncogenic pathway plays an important role in the expression of DNA repair genes and that these proteins could be used as predictive markers of tumors that will fail to respond to chemotherapy. | |
| 20491486 | A second divalent magnesium (Mg2+) ion in addition to the one forming the Mg adenosine triphosphate (MgATP) complex is required to bind to cdk5/p25 for its catalytic activity, suggesting a rate-limiting phosphoryl transfer step. | |
| 20453000 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) | |
| 20357208 | CDK5 modulates mineralocorticoid receptor-induced transcriptional activity in a kinase activity-dependent fashion. | |
| 20354813 | CDK5/p35 may represent a biomarker for prognosis in patients with non-small cell lung cancer | |
| 20345761 | Cdk5 is an upstream regulator of neurodegenerative pathways triggered by mitogen activated protein kinase p38alpha and a preferable therapeutic target for Alzheimer's Disease | |
| 20234188 | Cdk5 in the centriolar appendages mediates cenexin1 localization and primary cilia formation. | |
| 20213743 | Cdk5 can phosphorylate eNOS at the Ser-113 site and down-regulate eNOS-derived nitric oxide levels. | |
| 20133653 | Conversion of p35 to p25 does not alter the catalytic efficiency of the CDK5 catalytic subunit by using histone H1 or tau as substrates, and that neurotoxicity associated with CDK5/p25 is unlikely attributable to CDK5 hyperactivation. | |
| 20013135 | Data show that CDK5/p25 complexes were pulled apart by applying external forces with steered molecular dynamics, and suggest a CDK5 activation mechanism by p25. | |
| 19960242 | The present data indicate a novel target, P2X3 receptors, to express the action of Cdk5 on membrane proteins involved in pain perception. | |
| 19913121 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19822667 | Results link Cdk5 to Rho-ROCK signaling via Src and p190RhoGAP and implicate Cdk5 in the regulation of cell contraction, attachment, and migration. | |
| 19764350 | Cdk5 and p35 might play important roles in retinoic acid-induced HeLa apoptosis | |
| 19718565 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19700222 | Activation of transgenic c-Abl by amyloidbeta precursor protein promotes tau phosphorylation through Tyr15 phosphorylation-mediated cyclin-dependent protein kinase 5 (Cdk5) activation. | |
| 19693690 | CDK5-splicing variant might also be a negative regulator of Wnt/beta-catenin signaling pathway. | |
| 19692168 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19625176 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19615060 | Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) | |
| 19615060 | Our negative findings in the Spanish population argue against the hypothesis that CDK5 genetic variations are causally related to Alzheimer's disease risk | |
| 19514268 | Its deregulation causes neuronal death and neurodegenerative diseases. (review) | |
| 19514267 | plays a role in dopamine signaling and substance addiction. (review) | |
| 19514266 | regulates insulin secretion of pancreatic beta cells. (review) | |
| 19343042 | CDK5 promoter polymorphisms contribute to the genetic susceptibility to lung cancer in the Korean population. | |
| 19343042 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19170196 | Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator) | |
| 19050041 | Phosphorylation of parkin by casein kinase I and cdk5 decreases parkin solubility, leading to its aggregation and inactivation. | |
| 19001851 | REVIEW. crucial role of Cdk5 as a cell cycle suppressor in normal post-mitotic neurons; Cdk5 exits the nucleus in neurons risk to death in an AD patient's brain. The shift in sub-cellular location is accompanied by cell cycle re-entry and neuronal death. | |
| 18676680 | Observational study of gene-disease association. (HuGE Navigator) | |
| 18598350 | Observational study of gene-disease association. (HuGE Navigator) | |
| 18490454 | c-Abl and Cdk5 cooperatively regulate maximal activation of p53, resulting in neuronal death in response to oxidative stress by hydrogen peroxide. | |
| 18487454 | Cdk5 phosphorylates PIKE-A and stimulates its GTPase activity, which activates nuclear Akt and promotes glioblastoma cell migration and invasion. | |
| 18480410 | Cdk5 may cause Golgi fragmentation upon deregulation in Alzheimer's disease | |
| 18460467 | relative resistance to phosphatases might be a common feature of Cdk5 substrates and could contribute to the hyperphosphorylation of CRMP2 and Tau observed in Alzheimer disease | |
| 18408012 | Cdk5 activation in cells that overexpress cyclin G1 leads to c-Myc phosphorylation on Ser-62, which is responsible for cyclin G1-mediated transcriptional activation of cyclin B1. | |
| 18350355 | In our analysis, the haplotype tagged by the G allele of SNP rs2069442 was significantly associated with AD (p = 0.05). In conclusion, our study suggests that CDK5 may be associated with AD. | |
| 18350355 | Observational study of gene-disease association. (HuGE Navigator) | |
| 18326489 | Thr-138 phosphorylation plays a critical role in the control of the p35 functions in microtubule assembly and neurite outgrowth | |
| 18247371 | HIV-1 Tat hyperactivates CDK5 by interfering with it's nucleo-cytoplasmic translocation in neuronal cells | |
| 17713927 | Phosphorylation on a conserved Thr14 can inhibit activities of both the kinases, but phosphorylating another conserved Tyr15, however, can lead to totally opposite inhibition and stimulation consequences in CDK2 and CDK5. | |
| 17611284 | The Cdk5/DNA damage pathway is dysregulated in Huntington's disease. | |
| 17581253 | Results show that Cdk5, a critical signalling effector of various neurotoxic insults in the brain, is activated by EV71 infection of neuronal cells. | |
| 17493033 | Increased expression of Cdk5 was seen in stroke-affected tissue, with about a third showing increased p35 and p25 cleaved fragment. Increased Cdk5-, p-Cdk5- and p35-positive neurons and microvessels occurred in stroke-affected regions. | |
| 17491008 | microtubules play an important role in the control of Cdk5 activation | |
| 17145757 | Cdk5 kinase supports the proliferation of the medullary thyroid carcinoma cells. | |
| 17121855 | phosphorylation of Thr(138) predominantly defines the susceptibility of p35 to calpain-dependent cleavage and that dephosphorylation of this site is a critical determinant of Cdk5-p25-induced cell death associated with neurodegeneration | |
| 17060323 | p35 employs pathways distinct from that used by Cdk5 for transport to the nucleus | |
| 17045592 | phosphorylation of tau at Thr231 and Ser262 by cdk5 plus GSK-3, which inhibits its normal biological activity, is regulated both by its amino terminal inserts and its physical state | |
| 17036052 | nestin is a survival determinant whose action is based upon a novel mode of Cdk5 regulation, affecting the targeting, activity, and turnover of the Cdk5/p35 signaling complex | |
| 16413130 | Mediates exocytosis and decreases beta-amyloid peptide formation in Alzheimer disease. | |
| 16407256 | molecular analysis of the CDK5/p25 and CDK2/cyclin A systems | |
| 16327995 | This is the first report of cdk5/p35 expression and kinase activity in colon cancer cells, which is associated with ciglitazone-induced antiproliferation in HT-29 cells | |
| 15917097 | role of the CDK5 molecular complex in the genetic etiology of early-onset Alzheimer disease; a yet unknown functional variant in CDK5 or in a nearby gene might lead to increased susceptibility for early-onset Alzheimer disease | |
| 15911879 | These data predict that the ability of cdk5 phosphorylation to protect against htt cleavage, aggregation, and toxicity is compromised in cells expressing toxic fragments of htt. | |
| 15741232 | an early event in neuronal cell death is p25/Cdk5-mediated retinoblastoma phosphorylation | |
| 15492003 | data suggest that Cyclin-dependent kinase 5 (Cdk5)-Cdk5 activator p35 is required to elicit the maximum GTP-induced secretory response from neutrophils | |
| 15123618 | These results suggest that Cdk5/p35 and p25 are novel players in digoxin-triggered prostate cancer cell apoptosis and, therefore, become potential therapeutic targets. | |
| 15013773 | we show that alpha-chimaerin is a Cdk5p35-binding protein; in transfected HeLa cells, Cdk5p35 and alpha-chimaerin displayed an overlapping distribution pattern | |
| 12826674 | p25-Cdk5 is responsible for the mitotic-like phosphoepitopes present in neurofibrillary tangles and Cdk5 has a critical role in neurodegenerative mechanisms | |
| 12765608 | cdk5 can initiate a major impact on tau pathology progression that probably involves several kinases. | |
| 12491158 | HIV-1 Tat hyperactivates CDK5 by interfering with it's nucleo-cytoplasmic translocation in neuronal cells | |
| 12387894 | role in phosphorylation of tau protein | |
| 12372407 | CDK5 binds to roscovitine in the ATP-binding pocket | |
| 12071639 | This suggests a close, stable intermolecular association between cdk5 and phosphorylated tau, consistent with phosphorylation of tau by cdk5 in AD brain. | |
| 11865137 | Total cdk5 protein levels are significantly increased in progressive supranuclear palsy brain tissue. | |
| 11784720 | Our data suggest that neurotoxic insults lead to calpain-mediated conversion of p39 to p29, which might contribute to deregulation of Cdk5 |
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVL 1 - 70 HSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGEL 71 - 140 KLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDD 141 - 210 QLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEA 211 - 280 LQHPYFSDFCPP 281 - 292 //
| PMID | Year | Title | |
|---|---|---|---|
| 27107012 | 2016 | Pooled-matrix protein interaction screens using Barcode Fusion Genetics. | |
| 26966064 | 2016 | Transforming growth factor-?1 induces cell cycle arrest by activating atypical cyclin-dependent kinase 5 through up-regulation of Smad3-dependent p35 expression in human MCF10A mammary epithelial cells. | |
| 26930193 | 2016 | Parkinson-Related LRRK2 Mutation R1628P Enables Cdk5 Phosphorylation of LRRK2 and Upregulates Its Kinase Activity. | |
| 26871637 | 2016 | Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing. | |
| 26860827 | 2016 | An immunohistochemical study of cyclin-dependent kinase 5 (CDK5) expression in non-small cell lung cancer (NSCLC) and small cell lung cancer (SCLC): a possible prognostic biomarker. | |
| 26698249 | 2015 | Cyclin I promotes cisplatin resistance via Cdk5 activation in cervical cancer. | |
| 26690371 | 2015 | Targeting STAT3/miR-21 axis inhibits epithelial-mesenchymal transition via regulating CDK5 in head and neck squamous cell carcinoma. | |
| 26558783 | 2015 | Cdk5 Regulates Activity-Dependent Gene Expression and Dendrite Development. | |
| 26555036 | 2015 | Phosphorylation of a splice variant of collapsin response mediator protein 2 in the nucleus of tumour cells links cyclin dependent kinase-5 to oncogenesis. | |
| 26469698 | 2015 | Effects of p35 Mutations Associated with Mental Retardation on the Cellular Function of p35-CDK5. | |
| 26339373 | 2015 | Aberrant expression of CDK5 infers poor outcomes for nasopharyngeal carcinoma patients. | |
| 26317805 | 2015 | Enhancement of BACE1 Activity by p25/Cdk5-Mediated Phosphorylation in Alzheimer's Disease. | |
| 26268594 | 2015 | LRRK2 Facilitates tau Phosphorylation through Strong Interaction with tau and cdk5. | |
| 26206584 | 2015 | Cell cycle-dependent ubiquitylation and destruction of NDE1 by CDK5-FBW7 regulates ciliary length. | |
| 26206088 | 2016 | Phosphorylation of CHIP at Ser20 by Cdk5 promotes tAIF-mediated neuronal death. | |
| 26205145 | 2015 | Insights into the clinical value of cyclin-dependent kinase 5 in glioma: a retrospective study. | |
| 26057048 | 2015 | Acute and chronic stress differentially regulate cyclin-dependent kinase 5 in mouse brain: implications to glucocorticoid actions and major depression. | |
| 26027726 | 2015 | Cdk5 controls lymphatic vessel development and function by phosphorylation of Foxc2. | |
| 26018459 | 2015 | Cyclin-dependent kinase 5 regulates the proliferation, motility and invasiveness of lung cancer cells through its effects on cytoskeletal remodeling. | |
| 25931518 | 2015 | Combined Inhibition of Cyclin-Dependent Kinases (Dinaciclib) and AKT (MK-2206) Blocks Pancreatic Tumor Growth and Metastases in Patient-Derived Xenograft Models. | |
| 25928429 | 2015 | TIGAR regulates DNA damage and repair through pentosephosphate pathway and Cdk5-ATM pathway. | |
| 25852190 | 2015 | Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy. | |
| 25851605 | 2015 | Cyclin-dependent kinase 5 acts as a critical determinant of AKT-dependent proliferation and regulates differential gene expression by the androgen receptor in prostate cancer cells. | |
| 25829494 | 2015 | Heat shock inhibition of CDK5 increases NOXA levels through miR-23a repression. | |
| 25660209 | 2015 | Targeting cyclin dependent kinase 5 in hepatocellular carcinoma--A novel therapeutic approach. | |
| 25609066 | 2015 | Cyclin-dependent kinase 5 decreases in gastric cancer and its nuclear accumulation suppresses gastric tumorigenesis. | |
| 25572400 | 2015 | Cyclin-dependent kinase 5 phosphorylation of familial prion protein mutants exacerbates conversion into amyloid structure. | |
| 25560765 | 2015 | Autosomal recessive lissencephaly with cerebellar hypoplasia is associated with a loss-of-function mutation in CDK5. | |
| 25533468 | 2015 | Phosphorylation of synaptic GTPase-activating protein (synGAP) by Ca2+/calmodulin-dependent protein kinase II (CaMKII) and cyclin-dependent kinase 5 (CDK5) alters the ratio of its GAP activity toward Ras and Rap GTPases. | |
| 25452387 | 2014 | CDK5 is a major regulator of the tumor suppressor DLC1. | |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. | |
| 25346443 | 2015 | Cyclin-dependent kinase 5 regulates degranulation in human eosinophils. | |
| 25189171 | 2014 | Cdk5-mediated phosphorylation of RapGEF2 controls neuronal migration in the developing cerebral cortex. | |
| 24917152 | 2014 | Cdk5 phosphorylation of EFhd2 at S74 affects its calcium binding activity. | |
| 24851929 | 2014 | All-trans retinoic acid induces DU145 cell cycle arrest through Cdk5 activation. | |
| 24607229 | 2014 | Memory enhancement by targeting Cdk5 regulation of NR2B. | |
| 24548080 | 2014 | CDK5 protects from caspase-induced Ataxin-3 cleavage and neurodegeneration. | |
| 24362465 | 2014 | Dinaciclib (SCH727965) inhibits the unfolded protein response through a CDK1- and 5-dependent mechanism. | |
| 24235147 | 2013 | Cyclin-dependent kinase 5 (Cdk5) regulates the function of CLOCK protein by direct phosphorylation. | |
| 24135281 | 2013 | The role of Cdk5 in neuroendocrine thyroid cancer. | |
| 24121667 | 2013 | CDK5 is essential for TGF-?1-induced epithelial-mesenchymal transition and breast cancer progression. | |
| 24098701 | 2013 | Targeting p35/Cdk5 signalling via CIP-peptide promotes angiogenesis in hypoxia. | |
| 24091658 | 2013 | EGFR/MEK/ERK/CDK5-dependent integrin-independent FAK phosphorylated on serine 732 contributes to microtubule depolymerization and mitosis in tumor cells. | |
| 24085300 | 2013 | Structural basis for the different stability and activity between the Cdk5 complexes with p35 and p39 activators. | |
| 23941877 | 2013 | Cyclin-dependent kinase 5 modulates STAT3 and androgen receptor activation through phosphorylation of Ser?²? on STAT3 in prostate cancer cells. | |
| 23728742 | 2013 | Charcot-Marie-Tooth causing HSPB1 mutations increase Cdk5-mediated phosphorylation of neurofilaments. | |
| 23602568 | 2013 | The protein interaction landscape of the human CMGC kinase group. | |
| 23543736 | 2013 | Ubiquitin C-terminal hydrolase L1 (UCH-L1) acts as a novel potentiator of cyclin-dependent kinases to enhance cell proliferation independently of its hydrolase activity. | |
| 23455922 | 2013 | Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS. | |
| 23401660 | 2013 | Cyclin-dependent kinase 5 promotes the stability of corneal epithelial cell junctions. | |
| 23377270 | 2012 | Association between plasma biomarkers, CDK5 polymorphism and the risk of Alzheimer's disease. | |
| 23362255 | 2013 | Isomerase Pin1 stimulates dephosphorylation of tau protein at cyclin-dependent kinase (Cdk5)-dependent Alzheimer phosphorylation sites. | |
| 23332172 | 2013 | 5-Lipoxygenase pharmacological blockade decreases tau phosphorylation in vivo: involvement of the cyclin-dependent kinase-5. | |
| 23206597 | 2012 | Cyclin-dependent kinase 5 in axon growth and regeneration. | |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. | |
| 22964075 | 2013 | Cyclin-dependent kinase-5 and p35/p25 activators in schizophrenia and major depression prefrontal cortex: basal contents and effects of psychotropic medications. | |
| 22899714 | 2012 | Deregulated Cdk5 triggers aberrant activation of cell cycle kinases and phosphatases inducing neuronal death. | |
| 22874667 | S-nitrosylation of Cdk5: potential implications in amyloid-?-related neurotoxicity in Alzheimer disease. | ||
| 22833568 | 2012 | Interplay between MEK-ERK signaling, cyclin D1, and cyclin-dependent kinase 5 regulates cell cycle reentry and apoptosis of neurons. | |
| 22829587 | 2012 | Phosphoregulation of the RNA-binding protein Hu antigen R (HuR) by Cdk5 affects centrosome function. | |
| 22778260 | 2012 | Phosphorylation of gephyrin in hippocampal neurons by cyclin-dependent kinase CDK5 at Ser-270 is dependent on collybistin. | |
| 22753194 | 2012 | Cyclin-dependent kinase 5-mediated hyperphosphorylation of sirtuin-1 contributes to the development of endothelial senescence and atherosclerosis. | |
| 22745285 | 2012 | Synaptic vesicle pools and dynamics. | |
| 22696682 | 2012 | Achaete-scute homologue-1 (ASH1) stimulates migration of lung cancer cells through Cdk5/p35 pathway. | |
| 22547140 | 2012 | Association of rs2069459 in the CDK5 gene with dyslexia in a German cohort. | |
| 22223639 | 2012 | Cdk5 protein inhibition and A?42 increase BACE1 protein level in primary neurons by a post-transcriptional mechanism: implications of CDK5 as a therapeutic target for Alzheimer disease. | |
| 22078880 | 2011 | Adipocyte NCoR knockout decreases PPAR? phosphorylation and enhances PPAR? activity and insulin sensitivity. | |
| 21924349 | 2012 | Going out of the brain: non-nervous system physiological and pathological functions of Cdk5. | |
| 21922195 | 2012 | The impact of cyclin-dependent kinase 5 depletion on poly(ADP-ribose) polymerase activity and responses to radiation. | |
| 21844361 | 2011 | S-Nitrosylation activates Cdk5 and contributes to synaptic spine loss induced by beta-amyloid peptide. | |
| 21825040 | 2011 | Cyclin-dependent kinase 5 is amplified and overexpressed in pancreatic cancer and activated by mutant K-Ras. | |
| 21799006 | 2011 | Regulation of androgen receptor and prostate cancer growth by cyclin-dependent kinase 5. | |
| 21741478 | 2011 | Twice switched at birth: cell cycle-independent roles of the "neuron-specific" cyclin-dependent kinase 5 (Cdk5) in non-neuronal cells. | |
| 21712386 | 2011 | Activity-dependent phosphorylation of neuronal Kv2.1 potassium channels by CDK5. | |
| 21701498 | 2012 | Phosphorylation of HtrA2 by cyclin-dependent kinase-5 is important for mitochondrial function. | |
| 21671254 | 2011 | Inhibition of cyclin-dependent kinase 5 but not of glycogen synthase kinase 3-? prevents neurite retraction and tau hyperphosphorylation caused by secretable products of human T-cell leukemia virus type I-infected lymphocytes. | |
| 21668448 | 2011 | Glutathione-S-transferase P1 is a critical regulator of Cdk5 kinase activity. | |
| 21600237 | 2011 | Cdk5: mediator of neuronal development, death and the response to DNA damage. | |
| 21499257 | 2011 | Cdk5-mediated phosphorylation of endophilin B1 is required for induced autophagy in models of Parkinson's disease. | |
| 21482751 | 2011 | Pathogenic role of the X-linked cyclin-dependent kinase-like 5 and aristaless-related homeobox genes in epileptic encephalopathy of unknown etiology with onset in the first year of life. | |
| 21473899 | 2011 | Cdk5: multitasking between physiological and pathological conditions. | |
| 21465480 | 2012 | Cdk5 mediates vimentin Ser56 phosphorylation during GTP-induced secretion by neutrophils. | |
| 21442427 | 2011 | Cdk5 targets active Src for ubiquitin-dependent degradation by phosphorylating Src(S75). | |
| 21435449 | 2011 | Increased CDK5 expression in HIV encephalitis contributes to neurodegeneration via tau phosphorylation and is reversed with Roscovitine. | |
| 21415596 | 2011 | Nucleocytoplasmic Cdk5 is involved in neuronal cell cycle and death in post-mitotic neurons. | |
| 21335063 | 2011 | Cyclin-dependent kinase 5-dependent phosphorylation of Pctaire1 regulates dendrite development. | |
| 21289309 | 2011 | RNAi screen of the druggable genome identifies modulators of proteasome inhibitor sensitivity in myeloma including CDK5. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 21220307 | 2011 | Phosphorylation of glutamyl-prolyl tRNA synthetase by cyclin-dependent kinase 5 dictates transcript-selective translational control. | |
| 21209322 | 2011 | High NaCl-induced activation of CDK5 increases phosphorylation of the osmoprotective transcription factor TonEBP/OREBP at threonine 135, which contributes to its rapid nuclear localization. | |
| 21145489 | 2010 | The proapoptotic function of Noxa in human leukemia cells is regulated by the kinase Cdk5 and by glucose. | |
| 21144757 | 2011 | Design, synthesis, and testing of an 6-O-linked series of benzimidazole based inhibitors of CDK5/p25. | |
| 21044075 | 2010 | Regulation and role of cyclin-dependent kinase activity in neuronal survival and death. | |
| 20826806 | 2010 | Cyclin-dependent kinase 5 regulates endothelial cell migration and angiogenesis. | |
| 20720012 | 2010 | A 24-residue peptide (p5), derived from p35, the Cdk5 neuronal activator, specifically inhibits Cdk5-p25 hyperactivity and tau hyperphosphorylation. | |
| 20673369 | 2010 | Cdk5 phosphorylates non-genotoxically overexpressed p53 following inhibition of PP2A to induce cell cycle arrest/apoptosis and inhibits tumor progression. | |
| 20651683 | 2010 | Anti-diabetic drugs inhibit obesity-linked phosphorylation of PPARgamma by Cdk5. | |
| 20628086 | 2010 | Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study. | |
| 20559324 | 2010 | Cables1 protects p63 from proteasomal degradation to ensure deletion of cells after genotoxic stress. | |
| 20516069 | 2010 | The cdk5 kinase regulates the STAT3 transcription factor to prevent DNA damage upon topoisomerase I inhibition. | |
| 20491486 | 2010 | Kinetic mechanistic studies of Cdk5/p25-catalyzed H1P phosphorylation: metal effect and solvent kinetic isotope effect. | |
| 20453000 | 2010 | A Large-scale genetic association study of esophageal adenocarcinoma risk. | |
| 20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | ||
| 20357208 | 2010 | Cyclin-dependent kinase 5 modulates the transcriptional activity of the mineralocorticoid receptor and regulates expression of brain-derived neurotrophic factor. | |
| 20354813 | 2011 | Expression of CDK5/p35 in resected patients with non-small cell lung cancer: relation to prognosis. | |
| 20345761 | 2010 | Cdk5 is a major regulator of p38 cascade: relevance to neurotoxicity in Alzheimer's disease. | |
| 20234188 | 2010 | Cdk5 in the centriolar appendages mediates cenexin1 localization and primary cilia formation. | |
| 20213743 | 2010 | CDK5 phosphorylates eNOS at Ser-113 and regulates NO production. | |
| 20133653 | 2010 | No difference in kinetics of tau or histone phosphorylation by CDK5/p25 versus CDK5/p35 in vitro. | |
| 20061803 | 2010 | Cdk5, the multifunctional surveyor. | |
| 20013135 | 2010 | Mechanism of CDK5 activation revealed by steered molecular dynamics simulations and energy calculations. | |
| 19960242 | 2010 | The Cdk5 kinase downregulates ATP-gated ionotropic P2X3 receptor function via serine phosphorylation. | |
| 19913121 | 2009 | Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip. | |
| 19822667 | 2009 | Cdk5-dependent regulation of Rho activity, cytoskeletal contraction, and epithelial cell migration via suppression of Src and p190RhoGAP. | |
| 19782409 | 2009 | Making a neuron: Cdk5 in embryonic and adult neurogenesis. | |
| 19764350 | 2009 | The role of Cdk5 in retinoic acid-induced apoptosis of cervical cancer cell line. | |
| 19718565 | 2010 | Genetic variants of cyclin-dependent kinase 5 regulatory subunit associated protein 1-like 1 and transcription factor 7-like 2 are not associated with polycystic ovary syndrome in Chinese women. | |
| 19700222 | 2011 | c-Abl tyrosine kinase modulates tau pathology and Cdk5 phosphorylation in AD transgenic mice. | |
| 19693690 | 2010 | Characterization of a novel human CDK5 splicing variant that inhibits Wnt/beta-catenin signaling. | |
| 19692168 | 2010 | Genetic susceptibility to distinct bladder cancer subphenotypes. | |
| 19625176 | 2009 | PTEN identified as important risk factor of chronic obstructive pulmonary disease. | |
| 19615060 | 2009 | No association of CDK5 genetic variants with Alzheimer's disease risk. | |
| 19608861 | 2009 | Lysine acetylation targets protein complexes and co-regulates major cellular functions. | |
| 19514268 | 2009 | [Deregulation of Cdk5 in neuronal death and neurodegenerative diseases]. | |
| 19514267 | 2009 | [Role of Cdk5 in dopamine signaling and addiction]. | |
| 19514266 | 2009 | [Functions of Cdk5 in non-neuronal tissues: focusing on regulation of insulin secretion]. | |
| 19413330 | 2009 | Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. | |
| 19369195 | 2009 | Large-scale proteomics analysis of the human kinome. | |
| 19343042 | 2009 | Single-nucleotide polymorphisms in the promoter of the CDK5 gene and lung cancer risk in a Korean population. | |
| 19238148 | 2009 | Cell cycle, CDKs and cancer: a changing paradigm. | |
| 19170196 | 2009 | Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China. | |
| 19081376 | 2008 | Deregulation of HDAC1 by p25/Cdk5 in neurotoxicity. | |
| 19050041 | 2009 | Combined kinase inhibition modulates parkin inactivation. | |
| 19001851 | 2008 | Cdk5 and the non-catalytic arrest of the neuronal cell cycle. | |
| 18691976 | 2008 | Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. | |
| 18676680 | 2008 | Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway. | |
| 18598350 | 2008 | Impact of nine common type 2 diabetes risk polymorphisms in Asian Indian Sikhs: PPARG2 (Pro12Ala), IGF2BP2, TCF7L2 and FTO variants confer a significant risk. | |
| 18507738 | 2008 | Myristoylation of p39 and p35 is a determinant of cytoplasmic or nuclear localization of active cyclin-dependent kinase 5 complexes. | |
| 18490454 | 2008 | Cooperative roles of c-Abl and Cdk5 in regulation of p53 in response to oxidative stress. | |
| 18487454 | 2008 | Cdk5-mediated regulation of the PIKE-A-Akt pathway and glioblastoma cell invasion. | |
| 18480410 | 2008 | Novel genetic tools reveal Cdk5's major role in Golgi fragmentation in Alzheimer's disease. | |
| 18460467 | 2008 | Relative resistance of Cdk5-phosphorylated CRMP2 to dephosphorylation. | |
| 18408012 | 2008 | Cdk5-mediated phosphorylation of c-Myc on Ser-62 is essential in transcriptional activation of cyclin B1 by cyclin G1. | |
| 18350355 | 2008 | Cyclin-dependent kinase 5 is associated with risk for Alzheimer's disease in a Dutch population-based study. | |
| 18326489 | 2008 | Calmodulin binding and Cdk5 phosphorylation of p35 regulate its effect on microtubules. | |
| 18042622 | 2007 | Cdk5 regulates differentiation of oligodendrocyte precursor cells through the direct phosphorylation of paxillin. | |
| 17713927 | 2007 | The activation and inhibition of cyclin-dependent kinase-5 by phosphorylation. | |
| 17671990 | 2007 | Regulation of membrane association and kinase activity of Cdk5-p35 by phosphorylation of p35. | |
| 17611284 | 2007 | Phosphorylation of huntingtin by cyclin-dependent kinase 5 is induced by DNA damage and regulates wild-type and mutant huntingtin toxicity in neurons. | |
| 17591690 | 2007 | Stabilization and activation of p53 induced by Cdk5 contributes to neuronal cell death. | |
| 17581253 | 2007 | Enterovirus 71 triggering of neuronal apoptosis through activation of Abl-Cdk5 signalling. | |
| 17493033 | 2007 | Expression of cyclin-dependent kinase 5 mRNA and protein in the human brain following acute ischemic stroke. | |
| 17491008 | 2007 | Microtubule association of the neuronal p35 activator of Cdk5. | |
| 17344846 | 2007 | Patterns of somatic mutation in human cancer genomes. | |
| 17145757 | 2007 | Cdk5 regulates STAT3 activation and cell proliferation in medullary thyroid carcinoma cells. | |
| 17143272 | 2007 | Cdk5 regulates EphA4-mediated dendritic spine retraction through an ephexin1-dependent mechanism. | |
| 17121855 | 2007 | Suppression of calpain-dependent cleavage of the CDK5 activator p35 to p25 by site-specific phosphorylation. | |
| 17060323 | 2006 | Identification of nuclear import mechanisms for the neuronal Cdk5 activator. | |
| 17045592 | 2006 | Regulation of phosphorylation of tau by cyclin-dependent kinase 5 and glycogen synthase kinase-3 at substrate level. | |
| 17036052 | 2006 | A nestin scaffold links Cdk5/p35 signaling to oxidant-induced cell death. | |
| 17009320 | 2007 | cdk5 modulates beta- and delta-catenin/Pin1 interactions in neuronal cells. | |
| 16712791 | 2006 | Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags. | |
| 16519508 | 2006 | Cyclin-dependent protein kinase 5 primes microtubule-associated protein tau site-specifically for glycogen synthase kinase 3beta. | |
| 16413130 | 2006 | Cyclin-dependent kinase 5, Munc18a and Munc18-interacting protein 1/X11alpha protein up-regulation in Alzheimer's disease. | |
| 16407256 | 2006 | Different mechanisms of CDK5 and CDK2 activation as revealed by CDK5/p25 and CDK2/cyclin A dynamics. | |
| 16327995 | 2006 | CDK5 is a novel regulatory protein in PPARgamma ligand-induced antiproliferation. | |
| 16039528 | 2005 | Defining Cdk5 ligand chemical space with small molecule inhibitors of tau phosphorylation. | |
| 15992363 | 2005 | Activation of latent cyclin-dependent kinase 5 (Cdk5)-p35 complexes by membrane dissociation. | |
| 15917097 | Association of cyclin-dependent kinase 5 and neuronal activators p35 and p39 complex in early-onset Alzheimer's disease. | ||
| 15911879 | 2005 | Cdk5 phosphorylation of huntingtin reduces its cleavage by caspases: implications for mutant huntingtin toxicity. | |
| 15890360 | 2005 | Molecular basis for the specificity of p27 toward cyclin-dependent kinases that regulate cell division. | |
| 15790807 | 2005 | Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution. | |
| 15741232 | 2005 | p25/Cdk5-mediated retinoblastoma phosphorylation is an early event in neuronal cell death. | |
| 15689152 | 2005 | Mechanism of CDK5/p25 binding by CDK inhibitors. | |
| 15492003 | 2004 | GTP-dependent secretion from neutrophils is regulated by Cdk5. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15345747 | 2004 | Phosphoproteomic analysis of the developing mouse brain. | |
| 15342556 | 2004 | Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions. | |
| 15178331 | 2004 | Suppression of the caspase cleavage of beta-amyloid precursor protein by its cytoplasmic phosphorylation. | |
| 15123618 | 2004 | Involvement of Cdk5/p25 in digoxin-triggered prostate cancer cell apoptosis. | |
| 15030318 | 2004 | The T-cell protein tyrosine phosphatase is phosphorylated on Ser-304 by cyclin-dependent protein kinases in mitosis. | |
| 15013773 | 2004 | Alpha-chimaerin exists in a functional complex with the Cdk5 kinase in brain. | |
| 14741103 | 2004 | Cdk5 phosphorylation of doublecortin ser297 regulates its effect on neuronal migration. | |
| 14704270 | 2004 | Regulation of synaptojanin 1 by cyclin-dependent kinase 5 at synapses. | |
| 14521924 | 2003 | Apoptosis-associated tyrosine kinase is a Cdk5 activator p35 binding protein. | |
| 12972605 | 2003 | Puralpha is essential for postnatal brain development and developmentally coupled cellular proliferation as revealed by genetic inactivation in the mouse. | |
| 12963086 | 2004 | Co-purification and localization of Munc18-1 (p67) and Cdk5 with neuronal cytoskeletal proteins. | |
| 12855954 | 2003 | Cdk5 is essential for synaptic vesicle endocytosis. | |
| 12853948 | 2003 | The DNA sequence of human chromosome 7. | |
| 12832492 | 2003 | Cdk5 regulates the organization of Nestin and its association with p35. | |
| 12826674 | 2003 | Mitotic-like tau phosphorylation by p25-Cdk5 kinase complex. | |
| 12824184 | 2003 | Cyclin-dependent kinase-5 is involved in neuregulin-dependent activation of phosphatidylinositol 3-kinase and Akt activity mediating neuronal survival. | |
| 12796778 | 2003 | 14-3-3epsilon is important for neuronal migration by binding to NUDEL: a molecular explanation for Miller-Dieker syndrome. | |
| 12769842 | 2003 | Increased ezrin expression and activation by CDK5 coincident with acquisition of the senescent phenotype. | |
| 12765608 | 2003 | Cdk5 is a key factor in tau aggregation and tangle formation in vivo. | |
| 12691662 | 2003 | Cdk5-mediated inhibition of the protective effects of transcription factor MEF2 in neurotoxicity-induced apoptosis. | |
| 12690205 | 2003 | Human chromosome 7: DNA sequence and biology. | |
| 12491158 | 2002 | Tat-induced deregulation of neuronal differentiation and survival by nerve growth factor pathway. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12435421 | 2002 | Aberrant glycosylation modulates phosphorylation of tau by protein kinase A and dephosphorylation of tau by protein phosphatase 2A and 5. | |
| 12393264 | 2002 | Influence of phosphorylation of p35, an activator of cyclin-dependent kinase 5 (cdk5), on the proteolysis of p35. | |
| 12387894 | 2002 | Involvement of aberrant glycosylation in phosphorylation of tau by cdk5 and GSK-3beta. | |
| 12372407 | 2002 | Molecular model of cyclin-dependent kinase 5 complexed with roscovitine. | |
| 12372285 | 2002 | Fyn and Cdk5 mediate semaphorin-3A signaling, which is involved in regulation of dendrite orientation in cerebral cortex. | |
| 12226093 | 2002 | Truncation of CDK5 activator p35 induces intensive phosphorylation of Ser202/Thr205 of human tau. | |
| 12223541 | 2002 | The cyclin-dependent kinase 5 activators p35 and p39 interact with the alpha-subunit of Ca2+/calmodulin-dependent protein kinase II and alpha-actinin-1 in a calcium-dependent manner. | |
| 12154070 | 2002 | A novel centrosome-associated protein with affinity for microtubules. | |
| 12084709 | 2002 | Pctaire1 interacts with p35 and is a novel substrate for Cdk5/p35. | |
| 12077184 | 2002 | Cyclin-dependent kinase 5 phosphorylates disabled 1 independently of Reelin signaling. | |
| 12064478 | 2002 | Cdk5 phosphorylates p53 and regulates its activity. | |
| 12056836 | 2002 | Cyclin-dependent kinase-5/p35 phosphorylates Presenilin 1 to regulate carboxy-terminal fragment stability. | |
| 11955625 | 2002 | ik3-2, a relative to ik3-1/cables, is associated with cdk3, cdk5, and c-abl. | |
| 11882646 | 2002 | Identification of a neuronal Cdk5 activator-binding protein as Cdk5 inhibitor. | |
| 11865137 | 2002 | Increase of cdk5 is related to neurofibrillary pathology in progressive supranuclear palsy. | |
| 11823425 | 2002 | Cyclin-dependent kinase 5 prevents neuronal apoptosis by negative regulation of c-Jun N-terminal kinase 3. | |
| 11784720 | 2002 | Calpain-mediated cleavage of the cyclin-dependent kinase-5 activator p39 to p29. | |
| 11743029 | 2001 | The Cdk5-p35 kinase associates with the Golgi apparatus and regulates membrane traffic. | |
| 11741927 | 2002 | The protein SET binds the neuronal Cdk5 activator p35nck5a and modulates Cdk5/p35nck5a activity. | |
| 11733001 | 2001 | ik3-1/Cables is a substrate for cyclin-dependent kinase 3 (cdk 3). | |
| 11684694 | 2002 | Phosphorylation of MEK1 by cdk5/p35 down-regulates the mitogen-activated protein kinase pathway. | |
| 11675505 | 2001 | Regulation of NMDA receptors by cyclin-dependent kinase-5. | |
| 11604394 | 2001 | Phosphorylation of Pak1 by the p35/Cdk5 kinase affects neuronal morphology. | |
| 11584302 | 2001 | A decade of CDK5. | |
| 11583627 | 2001 | Structure and regulation of the CDK5-p25(nck5a) complex. | |
| 11483158 | 2001 | Glycogen synthase kinase3 beta phosphorylates serine 33 of p53 and activates p53's transcriptional activity. | |
| 11311121 | 2001 | The kinase DYRK phosphorylates protein-synthesis initiation factor eIF2Bepsilon at Ser539 and the microtubule-associated protein tau at Thr212: potential role for DYRK as a glycogen synthase kinase 3-priming kinase. | |
| 11278541 | 2001 | Mitotic reorganization of the intermediate filament protein nestin involves phosphorylation by cdc2 kinase. | |
| 11254741 | 2001 | Reactivity of anti-proliferating cell nuclear antigen (PCNA) murine monoclonal antibodies and human autoantibodies to the PCNA multiprotein complexes involved in cell proliferation. | |
| 11181841 | 2001 | Characterization of the in vitro phosphorylation of human tau by tau protein kinase II (cdk5/p20) using mass spectrometry. | |
| 11168528 | 2001 | p35/cdk5 binds and phosphorylates beta-catenin and regulates beta-catenin/presenilin-1 interaction. | |
| 11113134 | 2001 | Amphiphysin 1 binds the cyclin-dependent kinase (cdk) 5 regulatory subunit p35 and is phosphorylated by cdk5 and cdc2. | |
| 11104762 | 2001 | Phosphorylation of tau is regulated by PKN. | |
| 10995546 | 2000 | CROC-4: a novel brain specific transcriptional activator of c-fos expressed from proliferation through to maturation of multiple neuronal cell types. | |
| 10936190 | 2000 | Neuron-specific phosphorylation of Alzheimer's beta-amyloid precursor protein by cyclin-dependent kinase 5. | |
| 10896159 | 2000 | Cables links Cdk5 and c-Abl and facilitates Cdk5 tyrosine phosphorylation, kinase upregulation, and neurite outgrowth. | |
| 10884347 | 2000 | The C-terminal regulatory domain of p53 contains a functional docking site for cyclin A. | |
| 10762698 | 2000 | Cdk5 and MAPK are associated with complexes of cytoskeletal proteins in rat brain. | |
| 10721722 | 2000 | Cloning of three novel neuronal Cdk5 activator binding proteins. | |
| 10683146 | 2000 | p39 activates cdk5 in neurons, and is associated with the actin cytoskeleton. | |
| 10604473 | 1999 | Phosphorylation of DARPP-32 by Cdk5 modulates dopamine signalling in neurons. | |
| 10604467 | 1999 | Conversion of p35 to p25 deregulates Cdk5 activity and promotes neurodegeneration. | |
| 10544291 | 1999 | Neuron-specific Cdk5 kinase is responsible for mitosis-independent phosphorylation of c-Src at Ser75 in human Y79 retinoblastoma cells. | |
| 10500146 | 1999 | Regulation of cyclin-dependent kinase 5 catalytic activity by phosphorylation. | |
| 9832145 | 1998 | New phosphorylation sites identified in hyperphosphorylated tau (paired helical filament-tau) from Alzheimer's disease brain using nanoelectrospray mass spectrometry. | |
| 9822744 | 1998 | Evidence for the participation of the neuron-specific CDK5 activator P35 during laminin-enhanced axonal growth. | |
| 9771888 | 1998 | Tau is phosphorylated by GSK-3 at several sites found in Alzheimer disease and its biological activity markedly inhibited only after it is prephosphorylated by A-kinase. | |
| 9735171 | 1998 | Phosphorylation of tau at both Thr 231 and Ser 262 is required for maximal inhibition of its binding to microtubules. | |
| 9614189 | 1998 | The endogenous and cell cycle-dependent phosphorylation of tau protein in living cells: implications for Alzheimer's disease. | |
| 9596352 | 1998 | Cyclin-dependent kinase-5 is associated with lipofuscin in motor neurones in amyotrophic lateral sclerosis. | |
| 9565682 | 1998 | Characterization of tau phosphorylation in glycogen synthase kinase-3beta and cyclin dependent kinase-5 activator (p23) transfected cells. | |
| 9546672 | 1998 | Sequential phosphorylation of Tau by glycogen synthase kinase-3beta and protein kinase A at Thr212 and Ser214 generates the Alzheimer-specific epitope of antibody AT100 and requires a paired-helical-filament-like conformation. | |
| 9478941 | 1998 | Regulation of Munc-18/syntaxin 1A interaction by cyclin-dependent kinase 5 in nerve endings. | |
| 9422379 | 1998 | Cyclin D2 interacts with cdk-5 and modulates cellular cdk-5/p35 activity. | |
| 9396813 | 1997 | Identification of DNA replication and cell cycle proteins that interact with PCNA. | |
| 9353289 | 1997 | Phosphorylation by neuronal cdc2-like protein kinase promotes dimerization of Tau protein in vitro. | |
| 9199504 | 1997 | Phosphorylation of microtubule-associated protein tau by stress-activated protein kinases. | |
| 9150368 | 1997 | Interaction between Cdc37 and Cdk4 in human cells. | |
| 9030781 | 1997 | Biochemical and cellular effects of roscovitine, a potent and selective inhibitor of the cyclin-dependent kinases cdc2, cdk2 and cdk5. | |
| 9013862 | 1997 | GAK: a cyclin G associated kinase contains a tensin/auxilin-like domain. | |
| 8891282 | 1996 | Intracellular localization of cyclin-dependent kinase 5 (CDK5) in mouse neuron: CDK5 is located in both nucleus and cytoplasm. | |
| 8764598 | 1996 | In vitro phosphorylation of the cytoplasmic domain of the amyloid precursor protein by glycogen synthase kinase-3beta. | |
| 8702879 | 1996 | Site-specific phosphorylation of synapsin I by mitogen-activated protein kinase and Cdk5 and its effects on physiological functions. | |
| 8275715 | 1994 | Chromosomal mapping of human CDK2, CDK4, and CDK5 cell cycle kinase genes. | |
| 8090222 | 1994 | A brain-specific activator of cyclin-dependent kinase 5. | |
| 8090221 | 1994 | p35 is a neural-specific regulatory subunit of cyclin-dependent kinase 5. | |
| 7949095 | 1994 | Association of proliferating cell nuclear antigen with cyclin-dependent kinases and cyclins in normal and transformed human T lymphocytes. | |
| 7834371 | 1994 | Expression of CDK5 (PSSALRE kinase), a neural cdc2-related protein kinase, in the mature and developing mouse central and peripheral nervous systems. | |
| 7566346 | Hyperphosphorylation of tau in PHF. | ||
| 1639063 | 1992 | A family of human cdc2-related protein kinases. | |
| 1330687 | 1992 | p42 MAP kinase phosphorylation sites in microtubule-associated protein tau are dephosphorylated by protein phosphatase 2A1. Implications for Alzheimer's disease [corrected]. | |
| 1181841 | 1975 | Proceedings: Aneurysmal bone cysts of the spine. |
