Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.79
PubTator Score 3.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 472 0.0 0.0
Disease Target Count Z-score Confidence
Hormone producing pituitary cancer 3 4.136 2.1
Carney complex 24 3.271 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma -1.647 8.4e-08
malignant mesothelioma 1.500 2.2e-06
non primary Sjogren syndrome sicca 1.400 1.9e-02
osteosarcoma -1.439 1.7e-04
pituitary cancer -1.200 1.4e-06

Gene RIF (2)

AA Sequence

MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGS      1 - 70
QSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART                   71 - 126
//

Text Mined References (7)

PMID Year Title