Property Summary

NCBI Gene PubMed Count 39
PubMed Score 94.37
PubTator Score 46.56

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (23)

PMID Text
25785833 knockdown of CDK2AP1 in primary human fibroblasts reduced proliferation and induced premature senescence, with the observed phenotype being p53 dependent
24889487 In summary, p12CDK2AP1 expression in myxofibrosarcoma cells induces G0/G1 arrest and mitochondria dependent proapoptotic activity and down-regulation of p12CDK2AP1 by shRNAi results in up-regulation of the CDK2 transcript and protein.
24620959 Study reports that knockdown of CDK2AP1 by RNAi in glioma cells could effectively inhibit cell proliferation by inducing cell cycle arrest and apoptosis
23404055 CDK2AP1 plays an important role in modulating the growth and tumorigenesis of lung cancer cells.
22791769 Low CDK2AP1 expression is common and associated with adverse prognosis in nasopharyngeal carcinoma.
22427660 Human cyclin-dependent kinase 2-associated protein 1 (CDK2AP1) is dimeric in its disulfide-reduced state, with natively disordered N-terminal region
21865592 exerts its effect on stem cell maintenance/differentiation through epigenetic regulation [review]
21740085 In comparison with the healthy gingiva, the expression of Doc-1 was decreased, whereas the expression of S100A7 was upregulated in all oral lesions.
21328460 P12(CDK2AP1) is downregulated by miR-21
21187770 Missing down-regulation of the tumor-suppressor gene DOC-1, might exert protective effects and counteract malignant transformation of benign, proliferating lesions of the oral cavity.
20727496 The combination of an increased expression of the antimicrobial peptide DEFA-4, the oncogene S100-A7, epidermal growth factor, and tenascin-c, and a decreased Doc-1 expression in oral leukoplakia might characterize its potency of malignant transformation.
20555355 CDK2AP1 is a novel multiple sclerosis susceptibility loci, and it's risk allele correlates with diminished RNA expression of the cell cycle regulator CDK2AP1
20541561 Data support the role of cdk2ap1 as a tumor suppressor gene that can regulate squamous cell carcinoma growth in a cell autonomous manner through decreases in invasiveness and a non-cell autonomous manner through decreases in angiogenesis phenotypes.
20523938 Results indicate that DOC-1 is a bona fide subunit of the Mi-2/NuRD chromatin remodeling complex.
19679565 Data show low or moderate methylation was found in seven selected genes BAD, BBC3, CAV1, CDK2AP1, NPM1, PRKCDBP and THEM4.
19585490 The expression of cdk2ap1 correlated with a reduction in cellular growth, irrespective of inhibition or stimulation of androgen receptor (AR) signaling pathways
19513502 p12CDK2-AP1 is associated with tumor progression and a poor prognosis in esophageal squamous cell carcinoma.
19279387 expression negatively associated with a more advanced depth of tumor invasion and stage in gastric carcinoma
17689689 the del T poly (T) 8 observed in the 3'-UTR of the CDK2-AP1 gene in human microsatellite unstable colorectal cancer is functionally significant and results in decreased CDK2-AP1 expression
17217620 Resistance to TGF-beta 1-induced growth suppression is due to the disruption of its signaling pathway as a consequence of reduced or lost p12(CDK2-AP1).
15840587 p12CDK2-AP1 forms nuclear homodimers in contact inhibited normal diploid cells and dimerization of p12 is a necessary process for the growth inhibition effect by p12
14744761 plays a role in TGF-beta1-mediated growth suppression by modulating CDK2 activities and pRB phosphorylation
13679870 DOC1 has a differential expression in microsatellite-unstable human colorectal neoplasms.

AA Sequence

MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAII      1 - 70
EELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS                              71 - 115
//

Text Mined References (40)

PMID Year Title
25785833 2015 Knockdown of CDK2AP1 in primary human fibroblasts induces p53 dependent senescence.
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24889487 2014 Clinical aggressiveness of myxofibrosarcomas associates with down-regulation of p12CDK2AP1: prognostic implication of a putative tumor suppressor that induces cell cycle arrest and apoptosis via mitochondrial pathway.
24620959 2014 Knockdown of CDK2AP1 by RNA interference inhibits cell growth and tumorigenesis of human glioma.
24248101 2014 Interaction between p12CDK2AP1 and a novel unnamed protein product inhibits cell proliferation by regulating the cell cycle.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23404055 2013 Cyclin-dependent kinase 2-associated protein 1 suppresses growth and tumorigenesis of lung cancer.
22791769 2012 Expression of cyclin-dependent kinase 2-associated protein 1 confers an independent prognosticator in nasopharyngeal carcinoma: a cohort study.
22427660 2012 Human cyclin-dependent kinase 2-associated protein 1 (CDK2AP1) is dimeric in its disulfide-reduced state, with natively disordered N-terminal region.
21865592 2012 Double edge: CDK2AP1 in cell-cycle regulation and epigenetic regulation.
21740085 2011 Risk estimation for a malignant transformation of oral lesions by S100A7 and Doc-1 gene expression.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21328460 2011 miR-21 downregulates the tumor suppressor P12 CDK2AP1 and stimulates cell proliferation and invasion.
21187770 2011 High ?-defensin and S100A7 expression and missing DOC-1 down-regulation characterize irritation fibromas of the oral cavity and may counteract malignant transformation.
20727496 2010 Gene expression of oncogenes, antimicrobial peptides, and cytokines in the development of oral leukoplakia.
20555355 2010 IL12A, MPHOSPH9/CDK2AP1 and RGS1 are novel multiple sclerosis susceptibility loci.
20541561 2010 Novel tumor growth inhibition mechanism by cell cycle regulator cdk2ap1 involves antiangiogenesis modulation.
20523938 2010 CDK2AP1/DOC-1 is a bona fide subunit of the Mi-2/NuRD complex.
19679565 2009 The DNA methylome of pediatric acute lymphoblastic leukemia.
19585490 2009 Cell cycle regulator cdk2ap1 inhibits prostate cancer cell growth and modifies androgen-responsive pathway function.
19513502 2009 p12CDK2-AP1 is associated with tumor progression and a poor prognosis in esophageal squamous cell carcinoma.
19279387 2009 Decreased expression of p12 is associated with more advanced tumor invasion in human gastric cancer tissues.
17689689 2007 A del T poly T (8) mutation in the 3' untranslated region (UTR) of the CDK2-AP1 gene is functionally significant causing decreased mRNA stability resulting in decreased CDK2-AP1 expression in human microsatellite unstable (MSI) colorectal cancer (CRC).
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17217620 2006 Loss of p12CDK2-AP1 expression in human oral squamous cell carcinoma with disrupted transforming growth factor-beta-Smad signaling pathway.
16541075 2006 The finished DNA sequence of human chromosome 12.
15840587 2005 Mutation of Cys105 inhibits dimerization of p12CDK2-AP1 and its growth suppressor effect.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14985111 2004 Interaction of the CDK2-associated protein-1, p12(DOC-1/CDK2AP1), with its homolog, p14(DOC-1R).
14744761 2004 Role of p12(CDK2-AP1) in transforming growth factor-beta1-mediated growth suppression.
13679870 2003 Differential expression of DOC-1 in microsatellite-unstable human colorectal cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10938106 2000 p12(DOC-1) is a novel cyclin-dependent kinase 2-associated protein.
10877824 2000 p12(DOC-1), a growth suppressor, associates with DNA polymerase alpha/primase.
9506968 1998 Cloning, mapping, expression, function, and mutation analyses of the human ortholog of the hamster putative tumor suppressor gene Doc-1.
9331572 1997 Isolation, mapping and mutation analysis of a human cDNA homologous to the doc-1 gene of the Chinese hamster, a candidate tumor suppressor for oral cancer.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.