Property Summary

NCBI Gene PubMed Count 18
PubMed Score 61.49
PubTator Score 352.28

Knowledge Summary

Patent (26,745)

TINX Plot

  Disease (2)

Disease Target Count
Alcoholic Intoxication, Chronic 41
Disease Target Count P-value
malignant mesothelioma 3163 4.1e-06
psoriasis 6685 1.0e-03
medulloblastoma, large-cell 6234 4.2e-03

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.300 4.1e-06
psoriasis -1.400 1.0e-03
medulloblastoma, large-cell -1.100 4.2e-03

Gene RIF (8)

PMID Text
25500144 A CCRK-EZH2 epigenetic circuitry drives hepatocarcinogenesis and associates with tumor recurrence and poor survival of patient.
23743448 In glioblastoma cells with deregulated high levels of CCRK, its depletion restores cilia through ICK and an ICK-related kinase MAK, thereby inhibiting glioblastoma cell proliferation.
22875024 Data indicate that expression of ERAS, LHX1, and CCRK is increased in aggressive subgroups of medulloblastomas.
21747169 Cell cycle-related kinase is a direct androgen receptor-regulated gene that drives beta-catenin/T cell factor-dependent hepatocarcinogenesis
20466538 results suggest for the first time that CCRK is involved in colorectal cancer carcinogenesis and G1/S cell cycle transition by regulating Cdk2, cyclin E and Rb.
19672860 Overexpression of CCRK is associated with ovarian carcinoma.
16552187 Depletion of PNQALRE by >80% due to RNA interference (RNAi) impairs cell proliferation, but fails to arrest the cell cycle at a discrete point.
14597612 identification of p42, a novel cyclin-dependent kinase-activating kinase (CAK) activity in human cells; p42 is essential for the phosphorylation of Thr-160 and activation of CDK2 and is indispensable for cell growth

AA Sequence

MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAV      1 - 70
FPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQ     71 - 140
LKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQYDQGVDLWSVGCIMGELLNGSPLFPGKNDI    141 - 210
EQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAAS    211 - 280
KALLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILEG        281 - 346
//

Text Mined References (20)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25500144 2015 A CCRK-EZH2 epigenetic circuitry drives hepatocarcinogenesis and associates with tumor recurrence and poor survival of patients.
23743448 2013 CCRK depletion inhibits glioblastoma cell proliferation in a cilium-dependent manner.
22875024 2012 Functional genomics identifies drivers of medulloblastoma dissemination.
21986944 2012 Male germ cell-associated kinase is overexpressed in prostate cancer cells and causes mitotic defects via deregulation of APC/CCDH1.
21747169 2011 Cell cycle-related kinase is a direct androgen receptor-regulated gene that drives ?-catenin/T cell factor-dependent hepatocarcinogenesis.
20466538 2010 Functional characterisation of cell cycle-related kinase (CCRK) in colorectal cancer carcinogenesis.
19884882 2009 Cyclin-dependent kinases: a family portrait.
19672860 2009 Cell cycle-related kinase supports ovarian carcinoma cell proliferation via regulation of cyclin D1 and is a predictor of outcome in patients with ovarian carcinoma.
18508765 2008 Characterization of a novel cardiac isoform of the cell cycle-related kinase that is regulated during heart failure.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16552187 2006 The cyclin-dependent kinase (CDK) family member PNQALRE/CCRK supports cell proliferation but has no intrinsic CDK-activating kinase (CAK) activity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14597612 2004 p42, a novel cyclin-dependent kinase-activating kinase in mammalian cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.