Property Summary

NCBI Gene PubMed Count 485
PubMed Score 2522.82
PubTator Score 1582.97

Knowledge Summary

Patent (142,021)

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.183 7.0e-04
adult high grade glioma 2.100 2.3e-05
Astrocytoma, Pilocytic 1.400 9.0e-07
atypical teratoid / rhabdoid tumor 2.200 1.4e-09
colon cancer 1.400 1.3e-03
ependymoma 2.100 3.4e-15
glioblastoma 2.400 1.9e-11
group 3 medulloblastoma 2.500 1.7e-05
malignant mesothelioma 1.400 5.2e-07
medulloblastoma, large-cell 2.000 1.2e-03
osteosarcoma 2.505 6.9e-05
primitive neuroectodermal tumor 1.900 1.5e-04
psoriasis -1.400 1.3e-02

Synonym

Accession P24941 A8K7C6 O75100
Symbols CDKN2
p33(CDK2)

Gene

PDB

1H26   5UQ1   5UQ2   5UQ3   2CCH   2CCI   1H28   1BUH   2JGZ   2HIC   1AQ1   1B38   1B39   1CKP   1DI8   1DM2   1E1V   1E1X   1E9H   1F5Q   1FIN   1FQ1   1FVT   1FVV   1G5S   1GIH   1GII   1GIJ   1GY3   1GZ8   1H00   1H01   1H07   1H08   1H0V   1H0W   1H1P   1H1Q   1H1R   1H1S   1H24   1H25   1H27   1HCK   1HCL   1JST   1JSU   1JSV   1JVP   1KE5   1KE6   1KE7   1KE8   1KE9   1OGU   1OI9   1OIQ   1OIR   1OIT   1OIU   1OIY   1OKV   1OKW   1OL1   1OL2   1P2A   1P5E   1PF8   1PKD   1PW2   1PXI   1PXJ   1PXK   1PXL   1PXM   1PXN   1PXO   1PXP   1PYE   1QMZ   1R78   1URC   1URW   1V1K   1VYW   1VYZ   1W0X   1W8C   1W98   1WCC   1Y8Y   1Y91   1YKR   2A0C   2A4L   2B52   2B53   2B54   2B55   2BHE   2BHH   2BKZ   2BPM   2BTR   2BTS   2C4G   2C5N   2C5O   2C5V   2C5X   2C5Y   2C68   2C69   2C6I   2C6K   2C6L   2C6M   2C6O   2C6T   2CJM   2CLX   2DS1   2DUV   2EXM   2FVD   2G9X   2I40   2IW6   2IW8   2IW9   2J9M   2R3F   2R3G   2R3H   2R3I   2R3J   2R3K   2R3L   2R3M   2R3N   2R3O   2R3P   2R3Q   2R3R   2R64   2UUE   2UZB   2UZD   2UZE   2UZL   2UZN   2UZO   2V0D   2V22   2VTA   2VTH   2VTI   2VTJ   2VTL   2VTM   2VTN   2VTO   2VTP   2VTQ   2VTR   2VTS   2VTT   2VU3   2VV9   2W05   2W06   2W17   2W1H   2WEV   2WFY   2WHB   2WIH   2WIP   2WMA   2WMB   2WPA   2WXV   2X1N   2XMY   2XNB   3BHT   3BHU   3BHV   3DDP   3DDQ   3DOG   3EID   3EJ1   3EOC   3EZR   3EZV   3F5X   3FZ1   3IG7   3IGG   3LE6   3LFN   3LFQ   3LFS   3MY5   3NS9   3PJ8   3PXF   3PXQ   3PXR   3PXY   3PXZ   3PY0   3PY1   3QHR   3QHW   3QL8   3QQF   3QQG   3QQH   3QQJ   3QQK   3QQL   3QRT   3QRU   3QTQ   3QTR   3QTS   3QTU   3QTW   3QTX   3QTZ   3QU0   3QWJ   3QWK   3QX2   3QX4   3QXO   3QXP   3QZF   3QZG   3QZH   3QZI   3R1Q   3R1S   3R1Y   3R28   3R6X   3R71   3R73   3R7E   3R7I   3R7U   3R7V   3R7Y   3R83   3R8L   3R8M   3R8P   3R8U   3R8V   3R8Z   3R9D   3R9H   3R9N   3R9O   3RAH   3RAI   3RAK   3RAL   3RJC   3RK5   3RK7   3RK9   3RKB   3RM6   3RM7   3RMF   3RNI   3ROY   3RPO   3RPR   3RPV   3RPY   3RZB   3S00   3S0O   3S1H   3S2P   3SQQ   3SW4   3SW7   3TI1   3TIY   3TIZ   3TNW   3ULI   3UNJ   3UNK   3WBL   4ACM   4BCK   4BCM   4BCN   4BCO   4BCP   4BCQ   4BGH   4BZD   4CFM   4CFN   4CFU   4CFV   4CFW   4CFX   4D1X   4D1Z   4EK3   4EK4   4EK5   4EK6   4EK8   4EOI   4EOJ   4EOK   4EOL   4EOM   4EON   4EOO   4EOP   4EOQ   4EOR   4EOS   4ERW   4EZ3   4EZ7   4FKG   4FKI   4FKJ   4FKL   4FKO   4FKP   4FKQ   4FKR   4FKS   4FKT   4FKU   4FKV   4FKW   4FX3   4GCJ   4I3Z   4II5   4KD1   4LYN   4NJ3   4RJ3   5A14   5AND   5ANE   5ANG   5ANI   5ANJ   5ANK   5ANO   5CYI   5D1J   5FP5   5FP6   5IEV   5IEX   5IEY   5IF1   5JQ5   5JQ8   5K4J   5L2W   5LMK   5NEV  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (305)

AA Sequence

MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVI      1 - 70
HTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGA     71 - 140
IKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEID    141 - 210
QLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAA    211 - 280
LAHPFFQDVTKPVPHLRL                                                        281 - 298
//

Text Mined References (509)

PMID Year Title