Property Summary

Ligand Count 420
NCBI Gene PubMed Count 485
PubMed Score 2522.82
PubTator Score 1582.97

Knowledge Summary

Patent (142,021)

TINX Plot

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.183 7.0e-04
adult high grade glioma 2.100 2.3e-05
Astrocytoma, Pilocytic 1.400 9.0e-07
atypical teratoid / rhabdoid tumor 2.200 1.4e-09
colon cancer 1.400 1.3e-03
ependymoma 2.100 3.4e-15
glioblastoma 2.400 1.9e-11
group 3 medulloblastoma 2.500 1.7e-05
malignant mesothelioma 1.400 5.2e-07
medulloblastoma, large-cell 2.000 1.2e-03
osteosarcoma 2.505 6.9e-05
primitive neuroectodermal tumor 1.900 1.5e-04
psoriasis -1.400 1.3e-02

 GWAS Trait (1)

PDB (379)

Gene RIF (305)

AA Sequence

MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVI      1 - 70
HTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGA     71 - 140
IKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEID    141 - 210
QLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAA    211 - 280
LAHPFFQDVTKPVPHLRL                                                        281 - 298
//

Text Mined References (509)

PMID Year Title