Property Summary

Ligand Count 10
NCBI Gene PubMed Count 17
PubMed Score 18.00
PubTator Score 19.98

Knowledge Summary

Patent (3,925)

Expression

  Differential Expression (11)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.400 7.4e-03
medulloblastoma, large-cell -1.400 3.0e-04
osteosarcoma -1.384 1.4e-03
ovarian cancer -1.300 3.9e-06
Pick disease 1.100 3.2e-02
posterior fossa group B ependymoma -1.100 1.2e-05
primary pancreatic ductal adenocarcinoma 1.104 1.2e-02
psoriasis -1.200 6.2e-04
Rheumatoid arthritis 1.300 1.4e-02
subependymal giant cell astrocytoma -1.106 1.7e-02
tuberculosis 1.400 3.4e-07

Gene RIF (8)

AA Sequence

MDYDFKAKLAAERERVEDLFEYEGCKVGRGTYGHVYKARRKDGKDEKEYALKQIEGTGISMSACREIALL      1 - 70
RELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIH     71 - 140
YLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARH    141 - 210
YTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQ    211 - 280
KDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQ    281 - 350
IPYPKREFLNEDDPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTG    351 - 420
AGLQHSQDSSLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQS    421 - 490
SQYHPSHQAHRY                                                              491 - 502
//

Text Mined References (20)

PMID Year Title