Property Summary

NCBI Gene PubMed Count 38
PubMed Score 32.26
PubTator Score 21.29

Knowledge Summary

Patent (4,108)

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis -1.100 2.0e-02
psoriasis -1.900 1.9e-05
posterior fossa group B ependymoma -1.700 1.2e-14
medulloblastoma, large-cell -1.400 3.9e-05
adult high grade glioma -1.200 1.6e-04
pilocytic astrocytoma -1.100 7.7e-08
subependymal giant cell astrocytoma -1.108 2.8e-02
Breast cancer 1.100 1.4e-09
acute myeloid leukemia 1.200 2.5e-03

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (14)

PMID Text
26546806 CDK-16 upregulation in serous EOC cells may represent a negative feedback loop to promote ovarian cell differentiation in malignantly-transformed serous epithelial ovarian cancer cells
26205494 Activation of PCTAIRE-1 is mediated through interaction with the phosphorylated form of cyclin Y in complex with 14-3-3.
25809707 GALNT7 and CDK16 were confirmed to be the direct targets of miR-494. These results suggested that miR-494 play an inhibitory role in the tumorigenesis of NPC
25605337 PCTK1 regulates spindle orientation through phosphorylation of Ser83 on KAP0, a regulatory subunit of protein kinase A.
25402633 PCTK1 in the proliferation and survival of medulloblastoma characterized by cMYC amplification
25205104 An unexpected role for PCTAIRE1 in regulating p27 stability, mitosis, and tumor growth.
24931367 Pctaire1 exerts promyogenic effects by regulating myoblast migration and process formation during skeletal myogenesis
23692340 Dysfunction of MKL2 and its transcriptional coactivation partner, serum response factor (SRF), was supported by a decrease in gene and protein expression of PCTAIRE1, a downstream target of MKL2:SRF heterodimer transcriptional activation
22798068 a novel function of BRSK2 in the regulation of GSIS in beta-cells via a PCTAIRE1-dependent mechanism and suggest that BRSK2 is an attractive target for developing novel diabetic drugs.
22184064 CCNY binding to CDK16 required a region upstream of the kinase domain and was found to be inhibited by phosphorylation of serine 153, a potential PKA phosphorylation site.
21335063 Cdk5-dependent phosphorylation of Pctaire1 at Ser95 plays an important role in dendrite development
19460752 Knockdown of cyclin-dependent kinase 16 (CDK16; PCTAIRE) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16461345 Pctaire1 phosphorylates N-ethylmaleimide-sensitive fusion protein
12154078 Data show that various forms of PCTAIRE-1 transfected into neuroblastoma cell lines could either promote or inhibit neurite outgrowth, suggesting a potential role for the PCTAIRE-1 gene product in the control of neurite outgrowth.

AA Sequence

MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIV      1 - 70
HEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPADIRLPEGYLEKLTLNSPI     71 - 140
FDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIR    141 - 210
EVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQ    211 - 280
KVLHRDLKPQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGC    281 - 350
IFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEETWPGILSNEEFKTYNYPKYRAEALLSHAPRLDSDGA    351 - 420
DLLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPDSGRPAFR    421 - 490
VVDTEF                                                                    491 - 496
//

Text Mined References (45)

PMID Year Title
26546806 2015 Upregulated CDK16 Expression in Serous Epithelial Ovarian Cancer Cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26205494 2015 Cyclin Y phosphorylation- and 14-3-3-binding-dependent activation of PCTAIRE-1/CDK16.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25809707 2015 Functional elucidation of miR-494 in the tumorigenesis of nasopharyngeal carcinoma.
25605337 2015 PCTK1 regulates integrin-dependent spindle orientation via protein kinase A regulatory subunit KAP0 and myosin X.
25416956 2014 A proteome-scale map of the human interactome network.
25402633 2015 RNA interference screening identifies a novel role for PCTK1/CDK16 in medulloblastoma with c-Myc amplification.
25205104 2014 PCTAIRE1 phosphorylates p27 and regulates mitosis in cancer cells.
24931367 2014 Pctaire1/Cdk16 promotes skeletal myogenesis by inducing myoblast migration and fusion.
23692340 2014 Genetic variation in MKL2 and decreased downstream PCTAIRE1 expression in extreme, fatal primary human microcephaly.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22798068 2012 Brain-selective kinase 2 (BRSK2) phosphorylation on PCTAIRE1 negatively regulates glucose-stimulated insulin secretion in pancreatic ?-cells.
22796189 2012 Analysis of substrate specificity and cyclin Y binding of PCTAIRE-1 kinase.
22184064 2012 Cyclin-dependent kinase 16/PCTAIRE kinase 1 is activated by cyclin Y and is essential for spermatogenesis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21335063 2011 Cyclin-dependent kinase 5-dependent phosphorylation of Pctaire1 regulates dendrite development.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19884882 2009 Cyclin-dependent kinases: a family portrait.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16461345 2006 Pctaire1 phosphorylates N-ethylmaleimide-sensitive fusion protein: implications in the regulation of its hexamerization and exocytosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16091426 2005 PCTAIRE protein kinases interact directly with the COPII complex and modulate secretory cargo transport.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12154078 2002 Regulation of the CDK-related protein kinase PCTAIRE-1 and its possible role in neurite outgrowth in Neuro-2A cells.
12084709 2002 Pctaire1 interacts with p35 and is a novel substrate for Cdk5/p35.
10099831 1999 The cellular distribution and kinase activity of the Cdk family member Pctaire1 in the adult mouse brain and testis suggest functions in differentiation.
9799109 1998 Characterization of brain PCTAIRE-1 kinase immunoreactivity and its interactions with p11 and 14-3-3 proteins.
9244435 1997 Escape from X inactivation of two new genes associated with DXS6974E and DXS7020E.
9197417 1997 The Cdk-like protein PCTAIRE-1 from mouse brain associates with p11 and 14-3-3 proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8852665 1996 X inactivation analysis and DNA methylation studies of the ubiquitin activating enzyme E1 and PCTAIRE-1 genes in human and mouse.
8088790 1994 Cloning of genomic loci and chromosomal localization of the human PCTAIRE-1 and -3 protein kinase genes.
7656587 1995 Physical linkage of the cdc2-related gene (PCTK1) and the ubiquitin-activating enzyme E1 gene (UBE1) on human Xp11.3.
1639063 1992 A family of human cdc2-related protein kinases.
1437147 1992 PCTAIRE-1 and PCTAIRE-3, two members of a novel cdc2/CDC28-related protein kinase gene family.