Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.78
PubTator Score 0.69

Knowledge Summary

Patent (872)

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis -2.463 5.4e-07
atypical teratoid / rhabdoid tumor 1.300 4.7e-03
glioblastoma 1.100 1.8e-02
medulloblastoma, large-cell 1.900 5.2e-05
adult high grade glioma 1.600 7.5e-04
ovarian cancer 1.600 5.6e-10

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (1)

PMID Text
24866247 In summary, our results suggest that ALS2CR7 confers TRAIL resistance to cancer cells via phosphorylation of survivin.

AA Sequence

MGQELCAKTVQPGCSCYHCSEGGEAHSCRRSQPETTEAAFKLTDLKEASCSMTSFHPRGLQAARAQKFKS      1 - 70
KRPRSNSDCFQEEDLRQGFQWRKSLPFGAASSYLNLEKLGEGSYATVYKGISRINGQLVALKVISMNAEE     71 - 140
GVPFTAIREASLLKGLKHANIVLLHDIIHTKETLTFVFEYMHTDLAQYMSQHPGGLHPHNVRLFMFQLLR    141 - 210
GLAYIHHQHVLHRDLKPQNLLISHLGELKLADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSE    211 - 280
LDIWGAGCIFIEMFQGQPLFPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPTPRSLHVV    281 - 350
WNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKPEMCDLLA    351 - 420
SYQKGHHPAQFSKCW                                                           421 - 435
//

Text Mined References (15)

PMID Year Title
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24866247 2014 ALS2CR7 (CDK15) attenuates TRAIL induced apoptosis by inducing phosphorylation of survivin Thr34.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
19884882 2009 Cyclin-dependent kinases: a family portrait.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236519 2005 Mammalian cyclin-dependent kinases.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471243 2002 The protein kinase complement of the human genome.
11586298 2001 A gene encoding a putative GTPase regulator is mutated in familial amyotrophic lateral sclerosis 2.