Property Summary

Ligand Count 4
NCBI Gene PubMed Count 30
PubMed Score 20.47
PubTator Score 12.86

Knowledge Summary

Patent (2,689)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.200 3.3e-02
ependymoma 1.300 1.6e-02
Gaucher disease type 1 -1.400 3.3e-03
group 3 medulloblastoma 1.100 1.3e-02
juvenile dermatomyositis 1.042 1.1e-06
malignant mesothelioma 1.600 9.5e-06
oligodendroglioma 1.300 8.9e-03
osteosarcoma 1.953 6.4e-05
ovarian cancer -1.100 9.4e-07
pancreatic ductal adenocarcinoma liver m... 2.683 3.1e-04
Pick disease 1.600 2.9e-08

Gene RIF (9)

AA Sequence

MPSSSDTALGGGGGLSWAEKKLEERRKRRRFLSPQQPPLLLPLLQPQLLQPPPPPPPLLFLAAPGTAAAA      1 - 70
AAAAAASSSCFSPGPPLEVKRLARGKRRAGGRQKRRRGPRAGQEAEKRRVFSLPQPQQDGGGGASSGGGV     71 - 140
TPLVEYEDVSSQSEQGLLLGGASAATAATAAGGTGGSGGSPASSSGTQRRGEGSERRPRRDRRSSSGRSK    141 - 210
ERHREHRRRDGQRGGSEASKSRSRHSHSGEERAEVAKSGSSSSSGGRRKSASATSSSSSSRKDRDSKAHR    211 - 280
SRTKSSKEPPSAYKEPPKAYREDKTEPKAYRRRRSLSPLGGRDDSPVSHRASQSLRSRKSPSPAGGGSSP    281 - 350
YSRRLPRSPSPYSRRRSPSYSRHSSYERGGDVSPSPYSSSSWRRSRSPYSPVLRRSGKSRSRSPYSSRHS    351 - 420
RSRSRHRLSRSRSRHSSISPSTLTLKSSLAAELNKNKKARAAEAARAAEAAKAAEATKAAEAAAKAAKAS    421 - 490
NTSTPTKGNTETSASASQTNHVKDVKKIKIEHAPSPSSGGTLKNDKAKTKPPLQVTKVENNLIVDKATKK    491 - 560
AVIVGKESKSAATKEESVSLKEKTKPLTPSIGAKEKEQHVALVTSTLPPLPLPPMLPEDKEADSLRGNIS    561 - 630
VKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKR    631 - 700
CVDKFDIIGIIGEGTYGQVYKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEI    701 - 770
VTDKEDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIKC    771 - 840
SNILLNNRGQIKLADFGLARLYSSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFTK    841 - 910
KPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRKLREEFVFIPAAALDLFDYMLA    911 - 980
LDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHELWSKKRRRQKQMGMTDDVSTIKAPRKDLSLG    981 - 1050
LDDSRTNTPQGVLPSSQLKSQGSSNVAPVKTGPGQHLNHSELAILLNLLQSKTSVNMADFVQVLNIKVNS   1051 - 1120
ETQQQLNKINLPAGILATGEKQTDPSTPQQESSKPLGGIQPSSQTIQPKVETDAAQAAVQSAFAVLLTQL   1121 - 1190
IKAQQSKQKDVLLEERENGSGHEASLQLRPPPEPSTPVSGQDDLIQHQDMRILELTPEPDRPRILPPDQR   1191 - 1260
PPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKREGGIDYQAGDTYV   1261 - 1330
STSDYKDNFGSSSFSSAPYVSNDGLGSSSAPPLERRSFIGNSDIQSLDNYSTASSHSGGPPQPSAFSESF   1331 - 1400
PSSVAGYGDIYLNAGPMLFSGDKDHRFEYSHGPIAVLANSSDPSTGPESTHPLPAKMHNYNYGGNLQENP   1401 - 1470
SGPSLMHGQTWTSPAQGPGYSQGYRGHISTSTGRGRGRGLPY                               1471 - 1512
//

Text Mined References (47)

PMID Year Title