Property Summary

NCBI Gene PubMed Count 29
PubMed Score 24.33
PubTator Score 15.88

Knowledge Summary

Patent (2,754)

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.100 4.8e-02
psoriasis -1.500 2.0e-03
osteosarcoma -2.207 8.2e-10
group 3 medulloblastoma 1.500 8.7e-03
medulloblastoma, large-cell 1.500 3.4e-06
primitive neuroectodermal tumor 1.100 1.3e-04
intraductal papillary-mucinous adenoma (... 1.300 3.2e-02
intraductal papillary-mucinous carcinoma... 1.500 2.0e-02
Pick disease 1.100 3.9e-06
ovarian cancer 1.400 7.4e-04

Gene RIF (14)

PMID Text
26597175 Structures of CDK12/CycK complexes solved in the presence of AMP-PNP.
25712099 Data show that most mutations prevent formation of the cyclin-dependent kinase 12 (Cdk12)/cyclin K (CycK) complex, rendering the kinase inactive.
25561469 CDK12 and CDK13 losses in HCT116 cells preferentially affect expression of DNA damage response.
25429106 CDK12 affects RNA processing events in two distinct ways: Indirectly through generating factor-binding phospho-epitopes on the CTD of elongating RNAPII and directly through binding to specific factors
25384976 CDK12 plays an important role in cotranscriptional processing of c-FOS transcripts
24554720 many CDK12 mutations are an unrecognized cause of HR defects in ovarian cancers
24240700 CDK12 has properties that should confirm interest in its use as a biomarker.
22988298 Cyclin K1 is the primary cyclin partner for CDK12/CrkRS and it is required for activation of CDK12/CrkRS to phosphorylate the C-terminal domain of RNA Pol II.
22547058 CDK12 interacts with cyclin K and is required to maintain embryonnic stem cell self-renewal.
22012619 through regulation of expression of DNA damage response genes, CycK/Cdk12 protects cells from genomic instability
20952539 Data show that siRNA knockdown of hCDK12 in HeLa cells results in alterations in the CTD phosphorylation state.
20734064 Observational study of gene-disease association. (HuGE Navigator)
19651820 CRK7 modifies MAP kinases regulation and resistance to estrogen signaling inhibitors in breast cancers.
19124506 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDMGLVTPEAASLGTVIKPL      1 - 70
VEYDDISSDSDTFSDDMAFKLDRRENDERRGSDRSDRLHKHRHHQHRRSRDLLKAKQTEKEKSQEVSSKS     71 - 140
GSMKDRISGSSKRSNEETDDYGKAQVAKSSSKESRSSKLHKEKTRKERELKSGHKDRSKSHRKRETPKSY    141 - 210
KTVDSPKRRSRSPHRKWSDSSKQDDSPSGASYGQDYDLSPSRSHTSSNYDSYKKSPGSTSRRQSVSPPYK    211 - 280
EPSAYQSSTRSPSPYSRRQRSVSPYSRRRSSSYERSGSYSGRSPSPYGRRRSSSPFLSKRSLSRSPLPSR    281 - 350
KSMKSRSRSPAYSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAAAAAKMDGKES    351 - 420
KGSPVFLPRKENSSVEAKDSGLESKKLPRSVKLEKSAPDTELVNVTHLNTEVKNSSDTGKVKLDENSEKH    421 - 490
LVKDLKAQGTRDSKPIALKEEIVTPKETETSEKETPPPLPTIASPPPPLPTTTPPPQTPPLPPLPPIPAL    491 - 560
PQQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQANSQPPVQVSVKTQVSVTAAIPHLKTSTLPPL    561 - 630
PLPPLLPGDDDMDSPKETLPSKPVKKEKEQRTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPYKK    631 - 700
RPKICCPRYGERRQTESDWGKRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPIT    701 - 770
AIREIKILRQLIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFM    771 - 840
KQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLWYRPPELLLGE    841 - 910
ERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVWPDVIKLPYFNTMKPKKQYRR    911 - 980
RLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVELSKMAPPDLPHWQDCHELWSKKRRRQ    981 - 1050
RQSGVVVEEPPPSKTSRKETTSGTSTEPVKNSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLL   1051 - 1120
NLLQSQTDLSIPQMAQLLNIHSNPEMQQQLEALNQSISALTEATSQQQDSETMAPEESLKEAPSAPVILP   1121 - 1190
SAEQTTLEASSTPADMQNILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAACPPHIL   1191 - 1260
PPEKRPPEPPGPPPPPPPPPLVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYST   1261 - 1330
RPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGD   1331 - 1400
QDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGASSSGAGLHWGGPTQSSAYGK   1401 - 1470
LYRGPTRVPPRGGRGRGVPY                                                     1471 - 1490
//

Text Mined References (44)

PMID Year Title
26597175 2015 Structures of the CDK12/CycK complex with AMP-PNP reveal a flexible C-terminal kinase extension important for ATP binding.
25712099 2015 Ovarian carcinoma CDK12 mutations misregulate expression of DNA repair genes via deficient formation and function of the Cdk12/CycK complex.
25561469 2015 Characterization of human cyclin-dependent kinase 12 (CDK12) and CDK13 complexes in C-terminal domain phosphorylation, gene transcription, and RNA processing.
25429106 2015 Expression, purification, and identification of associated proteins of the full-length hCDK12/CyclinK complex.
25384976 2015 Cyclin-dependent kinase 12 increases 3' end processing of growth factor-induced c-FOS transcripts.
24662513 2014 The structure and substrate specificity of human Cdk12/Cyclin K.
24554720 2014 Ovarian cancer-associated mutations disable catalytic activity of CDK12, a kinase that promotes homologous recombination repair and resistance to cisplatin and poly(ADP-ribose) polymerase inhibitors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24240700 2014 Genome-wide profiling of genetic synthetic lethality identifies CDK12 as a novel determinant of PARP1/2 inhibitor sensitivity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22988298 2012 Interaction of cyclin-dependent kinase 12/CrkRS with cyclin K1 is required for the phosphorylation of the C-terminal domain of RNA polymerase II.
22547058 2012 Cyclin K-containing kinase complexes maintain self-renewal in murine embryonic stem cells.
22012619 2011 The Cyclin K/Cdk12 complex maintains genomic stability via regulation of expression of DNA damage response genes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21097718 2011 Genetic and structural variation in the gastric cancer kinome revealed through targeted deep sequencing.
20952539 2010 CDK12 is a transcription elongation-associated CTD kinase, the metazoan ortholog of yeast Ctk1.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19884882 2009 Cyclin-dependent kinases: a family portrait.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19651820 2009 CRK7 modifies the MAPK pathway and influences the response to endocrine therapy.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12841360 2003 Arrest of cell cycle by amida which is phosphorylated by Cdc2 kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11683387 2001 CrkRS: a novel conserved Cdc2-related protein kinase that colocalises with SC35 speckles.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.