Property Summary

NCBI Gene PubMed Count 39
PubMed Score 49.02
PubTator Score 25.45

Knowledge Summary

Patent (19,185)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (14)

PMID Text
20508983 Observational study of gene-disease association. (HuGE Navigator)
19520772 study identified p21 activated kinase 1 (PAK1) as a new CDK11(p58) substrate; mapped a new phosphorylation site of Ser174 on PAK1; results indicated PAK1 may serve as a downstream effector of CDK11(p58) during mitosis progression
19245811 Phosphorylation of the eukaryotic initiation factor 3f by cyclin-dependent kinase 11 during apoptosis.
19122208 These data identified a new negative regulatory protein of ERalpha and provided a new pathway by which CDK11(p58) negatively regulated cells.
17606997 findings show that, in addition to playing a role in spindle formation and structure, CDK11(p58) is also required for sister chromatid cohesion and the completion of mitosis
17177267 Observational study of gene-disease association. (HuGE Navigator)
17177267 CDC2L2 gene may contribute to the susceptibility of type 2 diabetes in the northern Han Chinese population.
16462731 mitotic CDK11(p58) isoform, but not the CDK11(p110) isoform, associates with mitotic centrosomes
16039607 These findings suggest that CDK11 may contribute to apoptosis by regulating the activity of NOT2 independent of its kinase activity.
16004605 CDK11p60 can contribute to apoptosis by direct signalling at the mitochondria, thereby amplifying Fas-induced apoptosis in melanoma cells.
15963510 CDK11(p58) is a new interacting protein and a novel regulator of histone acetyltransferase (HAT) HBO1.
15883043 CDK11 kinases could be regulated by interaction with 14-3-3 proteins during cell cycle and apoptosis
15330758 the PITSLRE IRES interacts with the Unr protein, which is more prominently expressed at the G2/M stage of the cell cycle
14511641 demonstrates that CDK11(p46) directly interacts with RanBPM in vitro and in human cells

AA Sequence

MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHCMEITIRNSPYRRE      1 - 70
DSMEDRGEEDDSLAIKPPQQMSRKEKVHHRKDEKRKEKWKHARVKEREHERRKRHREEQDKARREWERQK     71 - 140
RREMAREHSRRERDRLEQLERKRERERKMREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDY    141 - 210
SDKVKASHWSRSPPRPPRERFELGDGRKPGEARPAPAQKPAQLKEEKMEERDLLSDLQDISDSERKTSSA    211 - 280
ESSSAESGSGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSEDEE    281 - 350
RENENHLLVVPESRFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDSPALLPIELKQELPKYLPALQGC    351 - 420
RSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVRE    421 - 490
IVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSH    491 - 560
AGILKVGDFGLAREYGSPLKAYTPVVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGNS    561 - 630
EIDQINKVFKELGTPSEKIWPGYSELPVVKKMTFSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPGRRI    631 - 700
SAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQ    701 - 770
GASAAGPGFSLKF                                                             771 - 783
//

Text Mined References (40)

PMID Year Title
23178491 2014 CHK2 kinase promotes pre-mRNA splicing via phosphorylating CDK11(p110).
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
19884882 2009 Cyclin-dependent kinases: a family portrait.
19520772 2009 CDK11p58 phosphorylation of PAK1 Ser174 promotes DLC2 binding and roles on cell cycle progression.
19245811 2009 Phosphorylation of the eukaryotic initiation factor 3f by cyclin-dependent kinase 11 during apoptosis.
19122208 2009 Repression of estrogen receptor alpha by CDK11p58 through promoting its ubiquitin-proteasome degradation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17606997 2007 CDK11(p58) is required for the maintenance of sister chromatid cohesion.
17177267 2007 Genetic variations of the CDC2L2 gene are associated with type 2 diabetes in a Han Chinese cohort.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16039607 2005 The cyclin-dependent kinase 11 interacts with NOT2.
16004605 2005 Death-signal-induced relocalization of cyclin-dependent kinase 11 to mitochondria.
15963510 2005 Cyclin-dependent kinase 11(p58) interacts with HBO1 and enhances its histone acetyltransferase activity.
15883043 2005 The cyclin-dependent kinase 11 interacts with 14-3-3 proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15330758 2005 Regulation of the cell-cycle-dependent internal ribosome entry site of the PITSLRE protein kinase: roles of Unr (upstream of N-ras) protein and phosphorylated translation initiation factor eIF-2alpha.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231747 2004 A protein interaction framework for human mRNA degradation.
14511641 2003 The cyclin-dependent kinase 11(p46) isoform interacts with RanBPM.
12624090 2003 The C-terminal kinase domain of the p34cdc2-related PITSLRE protein kinase (p110C) associates with p21-activated kinase 1 and inhibits its activity during anoikis.
12501247 2003 CDK11 complexes promote pre-mRNA splicing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11980906 2002 Cyclin L is an RS domain protein involved in pre-mRNA splicing.
11683997 2001 Dopamine and glutamate induce distinct striatal splice forms of Ania-6, an RNA polymerase II-associated cyclin.
11506180 2001 Effect of p58GTA on beta-1,4-galactosyltransferase 1 activity and cell-cycle in human hepatocarcinoma cells.
11181995 2001 The sequence of the human genome.
10882096 2000 Identification and characterization of a novel cell cycle-regulated internal ribosome entry site.
9750192 1998 Duplication of a genomic region containing the Cdc2L1-2 and MMP21-22 genes on human chromosome 1p36.3 and their linkage to D1Z2.
9740677 1998 Isolation and characterization of two novel metalloproteinase genes linked to the Cdc2L locus on human chromosome 1p36.3.
9632733 1998 Phosphorylation of PITSLRE p110 isoforms accompanies their processing by caspases during Fas-mediated cell death.
9580558 1998 The RNP protein, RNPS1, associates with specific isoforms of the p34cdc2-related PITSLRE protein kinase in vivo.
9115219 1997 Cleavage of PITSLRE kinases by ICE/CASP-1 and CPP32/CASP-3 during apoptosis induced by tumor necrosis factor.
8195233 1994 Molecular cloning and expression of alternatively spliced PITSLRE protein kinase isoforms.
7920654 1994 Alterations in the PITSLRE protein kinase gene complex on chromosome 1p36 in childhood neuroblastoma.
7777541 1995 A region of consistent deletion in neuroblastoma maps within human chromosome 1p36.2-36.3.
2217177 1990 Increased expression of a 58-kDa protein kinase leads to changes in the CHO cell cycle.
1774066 1991 Localization of the expressed human p58 protein kinase chromosomal gene to chromosome 1p36 and a highly related sequence to chromosome 15.
1639388 1992 Structure and expression of the human p58clk-1 protein kinase chromosomal gene.