Property Summary

NCBI Gene PubMed Count 30
PubMed Score 24.00
PubTator Score 26.42

Knowledge Summary

Patent (5,072)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Melanoma 261 0.0 2.0
Disease Target Count Z-score Confidence
Tick infestation 16 3.354 1.7
Syndactyly 56 3.038 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.227 1.4e-05
glioblastoma -1.300 2.9e-05
medulloblastoma, large-cell -1.200 1.3e-04
intraductal papillary-mucinous adenoma (... 1.100 1.1e-02
ovarian cancer 2.500 2.4e-08

Gene RIF (9)

PMID Text
26392360 Down-regulated CDK10 expression frequently occurs in breast cancers and correlates with disease progression and poor survival
26209438 Results found that CDK10 mRNA expression was up-regulated in advanced breast neoplasm and positively correlated with C1orf63, which was consistent with the relationship of protein expression between C1orf63 and CDK10.
24218572 CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome.
23740091 Data suggest that reactivation of CDK10 might be utilized as a novel epigenetic strategy for the treatment of nasopharyngeal carcinomas (NPC) patients.
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of cyclin-dependent kinase 10 (CDK10) in U-937 macrophages
22326270 reduced Cdk10 expression is closely linked to hepatocellular carcinoma development and progression
22209942 CDK10 plays a crucial role in the growth and survivability of biliary tract cancer.
22158035 Data show that peptidyl-prolyl isomerase Pin1 silencing in SKBR-3 and MCF7 cells increased the cyclin-dependent kinase 10 (CDK10) expression.
19846932 CDK10 is not a target for aberrant DNA methylation in breast cancer.

AA Sequence

MAEPDLECEQIRLKCIRKEGFFTVPPEHRLGRCRSVKEFEKLNRIGEGTYGIVYRARDTQTDEIVALKKV      1 - 70
RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQV     71 - 140
KCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVKPMTPKVVTLWYRAPELL    141 - 210
LGTTTQTTSIDMWAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSKLPLVGQYSLRKQ    211 - 280
PYNNLKHKFPWLSEAGLRLLHFLFMYDPKKRATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPAT    281 - 350
SEGQSKRCKP                                                                351 - 360
//

Text Mined References (35)

PMID Year Title
26392360 2015 Decreased CDK10 expression correlates with lymph node metastasis and predicts poor outcome in breast cancer patients - a short report.
26209438 2015 Elevated C1orf63 expression is correlated with CDK10 and predicts better outcome for advanced breast cancers: a retrospective study.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24980573 2014 Identification of a melanoma susceptibility locus and somatic mutation in TET2.
24218572 2013 CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome.
23740091 2013 Promoter hypermethylation contributes to the frequent suppression of the CDK10 gene in human nasopharyngeal carcinomas.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22326270 2012 Clinical and biological significance of Cdk10 in hepatocellular carcinoma.
22209942 2012 CDK10 functions as a tumor suppressor gene and regulates survivability of biliary tract cancer cells.
22158035 2012 Proyl isomerase Pin1 facilitates ubiquitin-mediated degradation of cyclin-dependent kinase 10 to induce tamoxifen resistance in breast cancer cells.
21983787 2011 Genome-wide association study identifies three new melanoma susceptibility loci.
19846932 2009 CDK10 is not a target for aberrant DNA methylation in breast cancer.
19578364 2009 Genome-wide association study identifies three loci associated with melanoma risk.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18483556 2008 A genome-wide association study identifies novel alleles associated with hair color and skin pigmentation.
18242510 2008 Identification of CDK10 as an important determinant of resistance to endocrine therapy for breast cancer.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11313931 2001 Cdk10, a Cdc2-related kinase, associates with the Ets2 transcription factor and modulates its transactivation activity.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11006117 2000 Human CDK10 gene isoforms.
10036189 1999 The PISSLRE gene: structure, exon skipping, and exclusion as tumor suppressor in breast cancer.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8208557 1994 PISSLRE, a human novel CDC2-related protein kinase.
8084611 1994 Molecular cloning of PISSLRE, a novel putative member of the cdk family of protein serine/threonine kinases.
7882308 1995 Chromosomal mapping of members of the cdc2 family of protein kinases, cdk3, cdk6, PISSLRE, and PITALRE, and a cdk inhibitor, p27Kip1, to regions involved in human cancer.
7664269 1995 The cdc-2-related kinase, PISSLRE, is essential for cell growth and acts in G2 phase of the cell cycle.