Property Summary

Ligand Count 206
NCBI Gene PubMed Count 573
PubMed Score 1790.25
PubTator Score 1804.43

Knowledge Summary

Patent (99,621)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 5.879 2.9
Neuronal ceroid lipofuscinosis 28 3.222 1.6

Expression

  Differential Expression (34)

Disease log2 FC p
adrenocortical carcinoma 3.515 1.1e-06
adult high grade glioma 2.600 4.3e-05
astrocytoma 1.200 2.6e-06
Astrocytoma, Pilocytic 1.400 1.7e-04
Atopic dermatitis 1.900 3.4e-05
atypical teratoid / rhabdoid tumor 3.700 6.9e-11
Breast cancer 3.000 3.5e-02
breast carcinoma 2.500 6.7e-49
colon cancer 1.300 3.6e-02
ductal carcinoma in situ 2.800 5.2e-04
Endometriosis 1.963 5.7e-03
ependymoma 2.800 1.7e-10
esophageal adenocarcinoma 1.300 3.0e-02
glioblastoma 3.600 1.5e-12
group 3 medulloblastoma 4.500 3.1e-09
interstitial cystitis 1.600 2.6e-02
intraductal papillary-mucinous carcinoma... 3.900 1.3e-04
intraductal papillary-mucinous neoplasm ... 4.400 1.3e-03
invasive ductal carcinoma 3.600 5.5e-04
lung adenocarcinoma 1.101 5.0e-03
lung cancer 2.400 1.9e-04
malignant mesothelioma 1.200 4.3e-06
medulloblastoma, large-cell 4.000 1.3e-07
nasopharyngeal carcinoma 1.700 2.2e-06
non-small cell lung cancer 2.743 6.1e-30
oligodendroglioma 1.400 1.0e-05
ovarian cancer 2.700 2.4e-04
pancreatic cancer 1.900 1.9e-06
primary Sjogren syndrome 1.600 2.4e-03
primitive neuroectodermal tumor 4.200 8.0e-08
psoriasis 1.700 3.5e-08
tuberculosis -1.400 7.8e-04
ulcerative colitis 1.100 3.4e-03
Waldenstrons macroglobulinemia 1.099 3.0e-02

Protein-protein Interaction (12)

Gene RIF (375)

AA Sequence

MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVL      1 - 70
MQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKG     71 - 140
TIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEI    141 - 210
DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKM    211 - 280
ALNHPYFNDLDNQIKKM                                                         281 - 297
//

Text Mined References (599)

PMID Year Title