Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.95
PubTator Score 3.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Asthma 349 3.738 1.9
Disease Target Count Z-score Confidence
Common cold 63 3.973 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
lung adenocarcinoma -2.100 2.0e-08
posterior fossa group B ependymoma 2.100 1.2e-05
nasopharyngeal carcinoma -1.900 1.7e-05
lung carcinoma 2.200 6.7e-07
non-small cell lung carcinoma -1.800 1.5e-11
chronic rhinosinusitis -2.055 4.7e-02

Gene RIF (3)

PMID Text
26270739 CDHR3 is a susceptibility locus for early childhood Asthma with severe exacerbations.
25848009 the asthma susceptibility gene product CDHR3 mediates RV-C entry into host cells, and suggest that rs6967330 mutation could be a risk factor for RV-C wheezing illnesses.
24241537 the role of CDHR3 variants in the development of asthma with severe exacerbations based on genome-wide association study in Denmark

AA Sequence

MQEAIILLALLGAMSGGEALHLILLPATGNVAENSPPGTSVHKFSVKLSASLSPVIPGFPQIVNSNPLTE      1 - 70
AFRVNWLSGTYFEVVTTGMEQLDFETGPNIFDLQIYVKDEVGVTDLQVLTVQVTDVNEPPQFQGNLAEGL     71 - 140
HLYIVERANPGFIYQVEAFDPEDTSRNIPLSYFLISPPKSFRMSANGTLFSTTELDFEAGHRSFHLIVEV    141 - 210
RDSGGLKASTELQVNIVNLNDEVPRFTSPTRVYTVLEELSPGTIVANITAEDPDDEGFPSHLLYSITTVS    211 - 280
KYFMINQLTGTIQVAQRIDRDAGELRQNPTISLEVLVKDRPYGGQENRIQITFIVEDVNDNPATCQKFTF    281 - 350
SIMVPERTAKGTLLLDLNKFCFDDDSEAPNNRFNFTMPSGVGSGSRFLQDPAGSGKIVLIGDLDYENPSN    351 - 420
LAAGNKYTVIIQVQDVAPPYYKNNVYVYILTSPENEFPLIFDRPSYVFDVSERRPARTRVGQVRATDKDL    421 - 490
PQSSLLYSISTGGASLQYPNVFWINPKTGELQLVTKVDCETTPIYILRIQATNNEDTSSVTVTVNILEEN    491 - 560
DEKPICTPNSYFLALPVDLKVGTNIQNFKLTCTDLDSSPRSFRYSIGPGNVNNHFTFSPNAGSNVTRLLL    561 - 630
TSRFDYAGGFDKIWDYKLLVYVTDDNLMSDRKKAEALVETGTVTLSIKVIPHPTTIITTTPRPRVTYQVL    631 - 700
RKNVYSPSAWYVPFVITLGSILLLGLLVYLVVLLAKAIHRHCPCKTGKNKEPLTKKGETKTAERDVVVET    701 - 770
IQMNTIFDGEAIDPVTGETYEFNSKTGARKWKDPLTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEE    771 - 840
DELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK                             841 - 885
//

Text Mined References (11)

PMID Year Title
26270739 2015 Rhinovirus in the Pathogenesis and Clinical Course of Asthma.
25848009 2015 Cadherin-related family member 3, a childhood asthma susceptibility gene product, mediates rhinovirus C binding and replication.
24241537 2014 A genome-wide association study identifies CDHR3 as a susceptibility locus for early childhood asthma with severe exacerbations.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20833655 2010 Genome-wide association study identifies genetic determinants of warfarin responsiveness for Japanese.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.