Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.98
PubTator Score 8.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.900 2.9e-03
ependymoma -2.300 2.8e-03
oligodendroglioma -2.000 4.5e-03
glioblastoma -2.100 6.1e-06
medulloblastoma -2.100 4.7e-07
atypical teratoid / rhabdoid tumor -1.600 4.8e-03
medulloblastoma, large-cell -2.100 1.6e-03
primitive neuroectodermal tumor -1.400 1.4e-02
pediatric high grade glioma -1.400 1.7e-04
pilocytic astrocytoma -1.500 2.4e-05
lung carcinoma 3.300 1.3e-13

Gene RIF (4)

PMID Text
22846907 The CC genotype of rs4307059 located in the region between CDH9 and CDH10 is associated with completed suicide in a Polish cohort
21079607 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19404256 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17668045 Cadherin-9 is a reliable cell surface marker for fibroblasts in healthy and diseased kidneys.

AA Sequence

MRTYHYIPLFIWTYMFHTVDTILLQEKPNSYLSSKKIAGLTKDDGKMLRRTKRGWMWNQFFLLEEYTGTD      1 - 70
TQYVGKLHTDQDKGDGNLKYILTGDGAGSLFVIDENTGDIHAAKKLDREEKSLYILRAKAIDRKTGRQVE     71 - 140
PESEFIIKIHDINDNEPKFTKDLYTASVPEMSGVGTSVIQVTATDADDANYGNSAKVVYSILQGQPYFSV    141 - 210
DPESGIIKTALPDMSRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNNNPPRFPQSTYQFNSPES    211 - 280
VPLGTHLGRIKANDPDVGENAEMEYSIAEGDGADMFDVITDKDTQEGIITVKQNLDFENQMLYTLRVDAS    281 - 350
NTHPDPRFLHLGPFKDTAVVKISVEDIDEPPVFTKVSYLIEVDEDVKEGSIIGQVTAYDPDARNNLIKYS    351 - 420
VDRHTDMDRIFGIHSENGSIFTLKALDRESSPWHNITVTATEINNPKQSSHIPVFIRILDINDHAPEFAM    421 - 490
YYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFTLNPNFTIVDNKDNTAGIMTRKDGYSRNK    491 - 560
MSTYLLPILIFDNDYPIQSSTGTLTIRVCACDNQGNMQSCTAEALILSAGLSTGALVAILLCVLILLILV    561 - 630
VLFAALKRQRKKEPLIISKDDVRDNIVTYNDEGGGEEDTQAFDIGTLRNPEAREDSKLRRDVMPETIFQI    631 - 700
RRTVPLWENIDVQDFIHRRLKENDADPSAPPYDSLATYAYEGNDSIADSLSSLESLTADCNQDYDYLSDW    701 - 770
GPRFKKLADMYGGDDSDRD                                                       771 - 789
//

Text Mined References (15)

PMID Year Title
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23279374 2013 Genetic determinants of plasma ??-glycoprotein I levels: a genome-wide association study in extended pedigrees from Spain.
22872573 2012 Genome-wide association study of prognosis in advanced non-small cell lung cancer patients receiving platinum-based chemotherapy.
22846907 2012 Analysis of four genes involved in the neurodevelopment shows association of rs4307059 polymorphism in the cadherin 9/10 region with completed suicide.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21079607 2011 A genome-wide association study on common SNPs and rare CNVs in anorexia nervosa.
19404256 2009 Common genetic variants on 5p14.1 associate with autism spectrum disorders.
17668045 2007 Cadherin-9 is a novel cell surface marker for the heterogeneous pool of renal fibroblasts.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10861224 2000 Identification of three human type-II classic cadherins and frequent heterophilic interactions between different subclasses of type-II classic cadherins.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
7806582 1994 E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.
2059658 1991 Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue.