Property Summary

NCBI Gene PubMed Count 19
PubMed Score 17.84
PubTator Score 9.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 2.400 3.6e-08
astrocytic glioma -3.100 7.3e-04
posterior fossa group B ependymoma -4.100 1.1e-12
oligodendroglioma -3.000 2.4e-03
glioblastoma -3.500 7.6e-05
group 4 medulloblastoma -3.400 4.9e-04
cystic fibrosis -1.734 6.2e-03
atypical teratoid / rhabdoid tumor -3.100 4.8e-05
medulloblastoma, large-cell -3.600 2.4e-03
primitive neuroectodermal tumor -1.600 3.4e-02
adult high grade glioma -3.300 5.2e-04
pilocytic astrocytoma -3.600 6.8e-07
pituitary cancer 3.800 7.7e-07

 CSPA Cell Line (2)

Gene RIF (4)

PMID Text
21389276 cadherin 8, a type II neuronal cadherin, is expressed in cyst epithelia both in vivo and in vitro; data suggest that ectopic expression of cadherin 8 in renal epithelial cells is sufficient to cause the morphogenic pattern of cyst formation
20972252 Rare familial 16q21 microdeletions and expression analysis implicate CDH8 in susceptibility to autism and learning disabilities.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12209956 cadherin-8 may be involved in both kidney morphogenesis as well as tumorigenesis in some types of renal cell carcinoma

AA Sequence

MPERLAEMLLDLWTPLIILWITLPPCIYMAPMNQSQVLMSGSPLELNSLGEEQRILNRSKRGWVWNQMFV      1 - 70
LEEFSGPEPILVGRLHTDLDPGSKKIKYILSGDGAGTIFQINDVTGDIHAIKRLDREEKAEYTLTAQAVD     71 - 140
WETSKPLEPPSEFIIKVQDINDNAPEFLNGPYHATVPEMSILGTSVTNVTATDADDPVYGNSAKLVYSIL    141 - 210
EGQPYFSIEPETAIIKTALPNMDREAKEEYLVVIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSL    211 - 280
YHFSVPEDVVLGTAIGRVKANDQDIGENAQSSYDIIDGDGTALFEITSDAQAQDGIIRLRKPLDFETKKS    281 - 350
YTLKVEAANVHIDPRFSGRGPFKDTATVKIVVEDADEPPVFSSPTYLLEVHENAALNSVIGQVTARDPDI    351 - 420
TSSPIRFSIDRHTDLERQFNINADDGKITLATPLDRELSVWHNITIIATEIRNHSQISRVPVAIKVLDVN    421 - 490
DNAPEFASEYEAFLCENGKPGQVIQTVSAMDKDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAK    491 - 560
HNGFNRQKQEVYLLPIIISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNVEAYVLPIGLSMGALIAILAC    561 - 630
IILLLVIVVLFVTLRRHKNEPLIIKDDEDVRENIIRYDDEGGGEEDTEAFDIATLQNPDGINGFLPRKDI    631 - 700
KPDLQFMPRQGLAPVPNGVDVDEFINVRLHEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESTTSDSD    701 - 770
QNFDYLSDWGPRFKRLGELYSVGESDKET                                             771 - 799
//

Text Mined References (19)

PMID Year Title
24285895 2013 Prenatal ethanol exposure disrupts intraneocortical circuitry, cortical gene expression, and behavior in a mouse model of FASD.
23879678 2013 Identification of candidate intergenic risk loci in autism spectrum disorder.
23575222 2013 An eQTL mapping approach reveals that rare variants in the SEMA5A regulatory network impact autism risk.
23505434 2013 Pemphigus vulgaris autoantibody profiling by proteomic technique.
23144319 2013 Prognostic implications of genetic variants in advanced non-small cell lung cancer: a genome-wide association study.
22765916 2012 Cadherins and neuropsychiatric disorders.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
21389276 2011 Ectopic expression of cadherin 8 is sufficient to cause cyst formation in a novel 3D collagen matrix renal tubule culture.
20972252 2011 Rare familial 16q21 microdeletions under a linkage peak implicate cadherin 8 (CDH8) in susceptibility to autism and learning disability.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12209956 2002 Expression of cadherin-8 in renal cell carcinoma and fetal kidney.
10861224 2000 Identification of three human type-II classic cadherins and frequent heterophilic interactions between different subclasses of type-II classic cadherins.
9615235 1998 Localization of human cadherin genes to chromosome regions exhibiting cancer-related loss of heterozygosity.
9521872 1998 Molecular properties and chromosomal location of cadherin-8.
7982033 1994 Cloning of five human cadherins clarifies characteristic features of cadherin extracellular domain and provides further evidence for two structurally different types of cadherin.
2059658 1991 Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue.