1. Home
  2. Targets
  3. cell adhesion molecule
  4. cadherin
  5. Cadherin-5

Tbio Cadherin-5

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. This cadherin may play a important role in endothelial cell biology through control of the cohesion and organization of the intercellular junctions. It associates with alpha-catenin forming a link to the cytoskeleton. Acts in concert with KRIT1 to establish and maintain correct endothelial cell polarity and vascular lumen. These effects are mediated by recruitment and activation of the Par polarity complex and RAP1B. Required for activation of PRKCZ and for the localization of phosphorylated PRKCZ, PARD3, TIAM1 and RAP1B to the cell junction.

This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Functioning as a classical cadherin by imparting to cells the ability to adhere in a homophilic manner, this protein plays a role in endothelial adherens junction assembly and maintenance. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. [provided by RefSeq, Nov 2015]

 Comments

Property Summary

NCBI Gene PubMed Count 179
PubMed Score 812.50
PubTator Score 619.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0

Expression

  Differential Expression (18)

Disease log2 FC p
nephrosclerosis 1.337 1.1e-04
urothelial carcinoma 1.900 1.4e-05
psoriasis -1.700 1.0e-03
osteosarcoma -1.857 4.4e-02
medulloblastoma, large-cell -1.500 9.8e-05
juvenile dermatomyositis 1.148 7.3e-06
non-small cell lung cancer -2.526 1.8e-22
intraductal papillary-mucinous adenoma (... -1.200 1.6e-03
intraductal papillary-mucinous carcinoma... -1.300 2.0e-03
intraductal papillary-mucinous neoplasm ... -1.300 1.2e-02
lung cancer -1.900 4.1e-05
interstitial cystitis 1.700 1.1e-04
lung adenocarcinoma -2.821 6.7e-15
group 4 medulloblastoma -1.700 1.1e-04
lung carcinoma -2.300 2.5e-13
ductal carcinoma in situ -1.300 7.1e-04
invasive ductal carcinoma -1.900 3.7e-04
ulcerative colitis 1.400 1.9e-03

Synonym

Accession P33151 Q4VAI5 Q4VAI6
Symbols 7B4
CD144

Gene

CDH5

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (18)

See all...

 GO Function (4)

 GO Component (9)

 GO Process (9)

 Compartment GO Term (58)

See all...

 MGI Phenotype (15)

See all...

 HCA RNA Cell Line (48)

See all...

 CSPA Cell Line (4)

Pathway (18)

See all...

Protein-protein Interaction (76)

CTNND1   PAK3   JUP   VAV1   CTNNA1   VAV2   RAC1   PAK1   PAK2   VAV3   ACAD11   CTNNA2   PKP4   CEP57   MYO9B   ASPM   MYO1D   CTNNB1   ARVCF   GPAM   POP4   HADHA   ATF6   KEAP1   SGPL1   PTPRU   MYO5A   MYO5C   POLR3A   PKN3   HADHB   SREBF2   LTBP1   SCML1   TMTC3   SARAF   MYO1B   LRFN1   SNRNP200   POM121   MCRS1   TBL2   SBF1   OSBP   ZMYM1   EXOG   POLR1A   KIDINS220   PNPLA6   VANGL2   RYK   PLD1   PLD2   IQCB1   DAG1   WDR75   UTP15   TMEM57   ZNHIT2   ST7   TMEM39A   DNAJC1   MICU2   ITFG1   MICU1   RRP1   KCNJ8   PDZD8   RBFA   TIGD5   TSSC4   PIK3CB   TNFSF9   KCNJ11   VTI1B   CAPN15  

Gene RIF (154)

PMID Text
26921435 S-nitrosylation regulates endothelial cell VE-cadherin phosphorylation and internalization in microvascular permeability.
26728385 Data indicate that monoclonal antibody (mAb) against vascular endothelial cadherin 5 (VECDH5) has good binding ability and specificity.
26681130 Prophylactic UTI maintains the endothelial barrier function, increases VE-cadherin expression, and inhibits the phosphorylation of VE-cadherin at Tyr658 under inflammatory conditions
26663395 Rab11a/Rab11 family-interacting protein 2-mediated VE-cadherin recycling is required for formation of adherens junctions and restoration of vascular endothelial barrier integrity.
26598555 BMP-dependent physical interaction of VE-cadherin with the BMP receptor ALK2 (BMPRI) and BMPRII, resulting in stabilization of the BMP receptor complex and, thereby, the support of BMP6-Smad signaling.
26574545 ankyrin-G associates with and inhibits the endocytosis of VE-cadherin cis dimers.
26116572 our data show the importance of spatio-temporal regulation of the actin cytoskeleton through Trio and Rac1 at VE-cadherin-based cell-cell junctions in the maintenance of the endothelial barrier.
25869066 Girdin regulates the trafficking of VE-cadherin in synergy with R-Ras.
25800053 the transmembrane domain of VE-cadherin mediates an essential adapter function by binding directly to the transmembrane domain of VEGFR2, as well as VEGFR3.
25746323 MRTF-A and p300 activated the transcription of VE-cadherin gene by enhancing acetylation of histones.
25663699 VE-cadherin complexes are central force transducers in endothelial barrier in response to force.
25633318 Demonstrate that TrkB protects endothelial integrity during atherogenesis by promoting Ets1-mediated VE-cadherin expression and plays a previously unknown protective role in the development of coronary artery disease.
25559184 Suggest a new model of VE-cadherin adhesive interaction mediated by Rac1-induced reduction of mechanical tension at endothelial cell adherens junctions, resulting in the stabilization of VE-cadherin adhesions.
25548487 HIF-1alpha may modulate vascular mimicry in esophageal squamous cell carcinoma by regulating VE-cadherin expression.
25542764 The number of CD34/144 positive circulating endothelial cells was high in patients with large artery atherosclerosis who experienced chronic ischemic stroke. And this number may reflect severity of carotid atherosclerosis.
25501813 homophilic interactions of VE-cadherin stabilize it at cell borders and prevent entry into the lateral border recycling compartment.
25443888 stromal cells could desensitize imatinib and up-regulate VE-cadherin expression on Ph+ leukemia cells
25422846 the molecular basis for VE -cadherin control of the endothelial barrier function is of high interest for biomedical research, as vascular leakage is observed in many pathological conditions and human diseases.
25362142 preeclampsia does not significantly affect vascular growth or the expression of endothelial junction proteins in human placentas
25361430 insulin treatment has an effect on the expression of vascular endothelial cadherin and Beta-catenin in human fetoplacental vessels
25275457 Breast cancer cell incorporation into the vascular endothelium initiates by dislocating VE-cadherin at endothelial cell junctions.
25180771 clathrin-mediated and caveolae-mediated endocytosis of VE-cad contribute to lipopolysaccharide-induced vascular hyperpermeability.
25147336 NDPKB is required for VEGF-induced angiogenesis and contributes to the correct localization of VEGF receptor type 2 and VE-cadherin at the endothelial adherens junctions.
24965294 the relationship between VE-cadherin and capillary permeability in sepsis could not be demonstrated.
24965120 HIV-1 Tat C treated human brain microvascular endothelial cells result in downregulation and dissociation of VE-PTP and SHP2 from VE-cadherin
24877096 Elastase and cathepsin G are elevated in the plasma of HD patients, originating from primed PMNLs. In these patients, chronic elevation of these enzymes contributes to cleavage of VE-cadherin and possible disruption of endothelial integrity.
24820735 Increased levels of CD144 were found in patients with hypertension and hyperlipidemia.
24667918 HIV-1 Tat C treated human brain microvascular endothelial cells result in downregulation and dissociation of VE-PTP and SHP2 from VE-cadherin
24621569 remodeling. The endothelial-specific VE -cadherin/catenin complex provides the backbone of adherens junctions and acts in close interaction with actin filaments and actin/myosin-mediated contractility to fulfill the junction demands.
24603875 VE-cadherins forming transcellular bridges between two endothelial cells, are exchanged between cells in a phenomenon here termed trans-endocytosis.
24498454 This work is first to describe a mammalian cell surface protein, VE-cadherin, as a receptor for Leptospira interrogans.
24487320 Tyr685 and Tyr731 of VE-cadherin distinctly and selectively regulate the induction of vascular permeability or leukocyte extravasation
24469639 Increased serum levels of sVE-cadherin might be a novel biomarker for evaluating the severity of Henoch-Schonlein purpura and useful for identifying the presence of systemic vasculitis in inflammatory skin conditions.
24439748 Vascular endothelial cadherin is lost at the membrane when endothelial cells are exposed to TNF-alpha, IFN-gamma, and peripheral blood mononuclear cells (PBMC). IL-1ss can mimic the effects of PBMCs, indicating a role of IL-1ss in this process.
24430214 the molecular basis for VE-cadherin control of the endothelial barrier function is of high interest for biomedical research, as vascular leakage is observed in many pathological conditions and human diseases.
24227887 This coordinated mechanism controls VE-cadherin dynamics and cell motility and maintains monolayer integrity, thus potentially being relevant in disease and angiogenesis
24136461 T-cadherin up-regulation is involved in degradation of VE-cadherin, resulting in the disruption of endothelial barrier function.
24106276 Snail mediates TGF-beta1-induced down-regulation of VE-cadherin, which subsequently contributed to TGF-beta1-decreased trophoblast cell invasion.
24061286 Sera from patients (n=100) with various autoimmune diseases, including rheumatoid arthritis (n=23), systemic lupus erythematosus (SLE, n=31), systemic sclerosis (n=30), and Behcet's disease (BD, n=16) had circulating autoantibodies to VE-cadherin.
24046447 nitric oxide is a key molecule promoting endothelial cell permeability, linking the cytoskeleton to VE-cadherin phosphorylation through regulation of the endothelial-junction-associated Rac guanine-nucleotide-exchange factor (GEF) TIAM1.
23887639 Sirolimus-FKBP12.6 impairs endothelial barrier function by activation of protein kinase C-alpha and downstream disruption of the p120-VE cadherin interaction in vascular endothelium.
23868598 Taken together, these approaches to studying VE-cadherin status on microvascular endothelial cells are excellent complements to traditional permeability assays.
23645533 CDH5 Overexpression is associated with glioblastoma.
23635392 Reduced expression of VE-cadherin has to be considered as a major mechanism of increased vessel permeability in spesis-induced acute respiratory distress syndrome.
23554480 HIV-1 Tat C treated human brain microvascular endothelial cells result in downregulation and dissociation of VE-PTP and SHP2 from VE-cadherin
23474739 VE-cadherin and claudin-5 were studied in nasal polyp microvessels.
23465821 Chorionic gonadotropin induces vascular endothelial growth factor (VEGFA)-dependent downregulation of claudin 5, which increases the endothelial permeability in the coculture system.
23376478 Lycorine hydrochloride suppressed the expression of several key angiogenic genes, including VE-cadherin and Sema4D, and reduced Akt phosphorylation in Hey1B cells.
23325790 results demonstrate that the domain of VE-cadherin that binds to beta-catenin is required for the establishment of strong steady-state adhesion strength
23216791 N-cadherin is required to maintain the expression of VE-cadherin in malignant tumor cells but not vice versa. Thus, N-cadherin acts in concert with VE-cadherin to promote tumor growth.
23168683 Suggest that urocortin 1 increase LPS-induced endothelial permeability by disrupting the VE-cadherin-beta-catenin complex via activation of CRHR2.
23159740 A pivotal function of VE-cadherin homophilic interaction in modulating endothelial barrier through the tuning of microtubule dynamics.
23118492 Findings suggest that HMGB1, VEGF, sVE-cadherin and sEng regulate the angiogenesis in proliferative diabetic retinopathy.
23079531 serum cadherin-5 discriminated patients with recurrent breast cancer from those with no sign of recurrence with 90% specificity.
23074279 Data show that TIMP-2-mediated inhibition of vascular endothelial cell permeability involves an integrin alpha3beta1-Shp-1-cAMP/protein kinase A-dependent vascular endothelial cadherin cytoskeletal association.
22975327 This correlates with inhibition of vascular endothelial growth factor-A (VEGF-A)-induced signaling and stabilization of vascular endothelial (VE)-cadherin localization at endothelial junctions.
22922959 Intermedin plays a critical role in the vascular remodeling process and tumor angiogenesis by regulating vascular endothelial-cadherin and extracellular signal-regulated kinase.
22865455 Data show that CD133(+) and ABCB5(+) subpopulations are colocalized in melanomas in perivascular niches that contain CD144 (VE-cadherin)(+) melanoma cells forming vessel-like channels, a phenomenon termed vasculogenic mimicry (VM).
22833667 MDA-MB-231 cell-induced disruption of endothelial adherens junction integrity is triggered by MDA-MB-231 cell alpha(2)beta(1) integrin and is mediated by H-Ras/MLC-induced tyrosine phosphorylation of VE-cad.
22734943 The effects of mesenchymal stem cells on vascular network formation are abrogated by disruption of the VE-Cadherin/beta-catenin pathway in endothelial cells.
22720111 Upon infection by spotted fever group rickettsiae, phosphorylation of VE-cadherin directly attenuates homophilic protein-protein interactions at the endothelial adherens junctions dysfunction causing microvascular hyperpermeability.
22648953 p120 overexpression inhibits neutrophil migration independently of an effect on RhoA or Rac and instead blocks migration by preventing VE-cadherin tyrosine phosphorylation and association of active Src with the VE-cadherin complex
22562824 Bcl-2-dependent VE-cadherin overexpression may be an important mechanism by which hypoxia induces Vasculogenic mimicry
22398721 A VE-cadherin-PAR3-alpha-catenin complex regulates the Golgi localization and activity of cytosolic phospholipase A(2)alpha in endothelial cells.
22391038 Results implicate Vinculin-dependent VE-cadherin mechanosensing in endothelial processes such as leukocyte extravasation and angiogenesis.
22213015 VE-cadherin outside-in signaling controls locally Rac activity stimulated by barrier protective agonists.
22133903 The level of VE-Cad(low)alpha-SMA(+) progenitor cells was associated with the severity of coronary atherosclerosis as quantified by the Gensini score.
22064597 Subtype-selective induction of m-calpain in aorta during atherosclerotic progression is associated with proteolytic disorganization of VE-cadherin and proatherogenic hyperpermeability in cells.
22040113 FadA binds vascular endothelial cadherin and alters endothelial integrity.
21439626 the detection of a soluble VE-cadherin in the patient's serum during a ereditary angioedema attack might have potential clinical interest as a biomarker for the diagnosis
21269615 Oocyte donors receiving GnRH agonist or hCG did not show altered serum/follicular fluid VE-cadherin levels.
21190990 after VE-cadherin induction by DMP1, DMP1 inhibited VEGFR-2 phosphorylation and Src-mediated signaling; DMP1 is identified as a new specific inhibitor of VEGF-induced angiogenesis
21190742 Monocyte trans-endothelial migration alters endothelial junctional organization to a more monocyte-permeable state (increased PECAM-1 and decreased VE-cadherin), resulting in the augmented transmigratory activity at a later stage.
21168935 tyrosine phosphorylation of VE-cadherin is involved in the increased paracellular permeability of central nervous system-derived vascular endothelium induced by TGF-beta1
20926024 Soluble vascular endothelial cadherin (VE-cadherin) levels were investigated in a prospective study involving 28 consecutive critically ill patients with or without severe sepsis who were admitted to surgical intensive care.
20810734 virus induction of VEGF and reduction in VE-cadherin in the endothelial cell permeability seen in Hantavirus pulmonary syndrome
20732872 PDE4D tethers EPAC1 in a vascular endothelial cadherin (VE-Cad)-based signaling complex and controls cAMP-mediated vascular permeability
20711993 Studies indicate that a majority of adult BM HSCs derived from a VE-cadherin ancestor.
20693433 Identified is a new, transient, and rare cell population in the human embryonic liver, which coexpresses VE-cadherin, an endothelial marker, CD45, a pan-hematopoietic marker, and CD34, a common endothelial and hematopoietic marker.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20589320 mRNA levels of CD31, CD144, CD146 and vWf in whole blood as detected by real time RT-PCR cannot be used as biomarkers for end-stage endothelial cells such as circulating endothelial cells.
20470859 VE-cadherin and PECAM-1 enhance ALL migration across brain microvascular endothelial cell monolayers
20463083 Results suggest that pathogenic hantaviruses disrupt fluid barrier properties of endothelial cell adherens junctions by enhancing VEGFR2-VE-cadherin pathway responses which increase paracellular permeability.
20446815 Mesenchymal stem cells increased VE-cadherin levels and enhanced recruitment of both VE-cadherin and beta-catenin to the plasma membrane.
20386594 specific inhibition of the TGFbeta type I receptor blocked both RA-induced VE-cadherin expression and cell fusion
20167365 sustained expression of VE-cadherin in late onset preeclampsia could counteract VEGFR2 deficiency by enhancing survival pathway stimulation in the syncytiotrophoblast, thus preventing further decompensation of unbalanced villous trophoblast turnover.
20123970 Results suggest that VE-cadherin trafficking along filopodia using myosin-X motor protein is a prerequisite for cell-cell junction formation.
20048167 Data show that Src-induced tyrosine phosphorylation of VE-cadherin is not sufficient to promote an increase in endothelial cell monolayer permeability.
20032304 Data show that actin bundle formation and subsequent linkage between actin bundles and VE-cadherin through alpha- and beta-catenins are important for the stabilization of VE-cadherin at the cell-cell contacts in cAMP-Epac-Rap1 signal-activated cells.
19996314 Data show that TRPC4 co-precipitated with the junctional proteins beta-catenin and VE-cadherin.
19915944 the concentration of soluble form of vascular endothelial cadherin and IL-23 are raised in sera of patients with Behcet's disease compared with healthy controls
19913121 Observational study of gene-disease association. (HuGE Navigator)
19760520 VE-cadherin can be considered as a new prospective option in the combining treatment of aggressive tumor with highly vascularity, including osteosarcoma
19735546 One possible underlying molecular mechanism by which Genistein could inhibit vasculogenic mimicry formation of uveal melanoma is related to down-regulation of VE-cadherin.
19633358 VEGF leads to a Rac1-mediated generation of ROS, which, in turn, elevates the tyrosine phosphorylation of VE-cadherin and beta-catenin, ultimately regulating adherens junction integrity.
19420236 Stabilization of VE-cadherin adhesion by cross-bridging peptides may therefore be a novel therapeutic approach for the treatment of vascular hyperpermeability.
19356953 Expression of t-PA, PAI-1, TF, TFPI, TM, CD68 and VE-cadherin were significantly increased in the early symptomatic group, but the level of gene expression in the late symptomatic group was indistinguishable from the asymptomatic group.
19345098 Data show that VE-cadherin signals to Rho-kinase-dependent myosin light-chain 2 phosphorylation, leading to actomyosin contractility, which regulates the distribution of VE-cadherin at cell-cell junctions and sprouting.
19212436 Data show that cilengitide activated cell surface alphaVbeta3, stimulated phosphorylation of FAK, Src and VE-cadherin, increased cell permeability and decreased cell adhesion in endothelial cells.
19059243 VE-cadherin function in endothelial cells is intimately linked to vascular integrity and endothelial barrier plasticity.
18990449 the expression of VE-cadherin is dependent on mTOR and PI3K signaling.
18979298 VE-cadherin levels are not directly related to N-cadherin levels but may be inversely related due to competition for cadherin-associated Src substrate p120.
18804209 plasma endothelial-CD144+ has a role in coronary noncalcified plaques assessed by multidetector CT in a population of type 2 diabetic patients
18641366 VE-cad gap formation is required for leukocyte transmigration and identify p120 as a critical intracellular mediator of this process through its regulation of VE-cad expression at junctions.
18639387 Report a vessel type-specific expression pattern for VE-cadherin in regular human lung tissue, which is not influenced by age or sex.
18628953 Sox-9, ER81 and VE-cadherin have roles in retinoic acid-mediated trans-differentiation of breast cancer cells
18420943 ADAM10 is a novel regulator of vascular permeability and demonstrates a hitherto unknown function in the regulation of VE-cadherin-dependent endothelial cell functions and leukocyte transendothelial migration
18402976 Describe reproducible flow cytometric endothelial progenitor cell determination in human peripheral blood as CD34+/CD144+/CD3- lymphocyte sub-population.
18337748 These data indicate that VE-cadherin is a positive and endothelial cell-specific regulator of TGF-beta signalling.
18316602 VE-cadherin promotes breast cancer progression via transforming growth factor beta signaling
18287330 results suggest that VE-cadherin and beta-catenin binding dynamics are important determinants in microvascular barrier regulation
18272754 Addition of PBMCs to DV-2-infected HUVECs decreased the levels of mRNA transcripts and cell-surface expression of VE-cadherin.
18195090 a new pathway regulating angiogenesis and endothelial survival, via the transcription factor Erg and the adhesion molecule VE-cadherin.
18180305 VE-cadherin has a role in modulating c-Src activation in VEGF signaling
18163230 Endothelial cell junctional proteins respond to flow transiently by increasing the strength of intercellular attachments early after flow onset, supporting the view on the active role of intercellular adhesions in mechanotransduction.
17761936 basal Rho kinase activity was essential for proper expression of the adhesion molecule VE-cadherin in human vascular endothelial cells
17638851 Strategies targeting signals in the marrow microenvironment that amplify the Bcr-abl/VE-cadherin/beta-catenin axis may have utility in sensitizing drug-resistant leukemic stem cells.
17194459 OxidizedLDL downregulated VE Cadherin on endothelial junctions in an in vitro model of transendothelial monocyte migration
17159998 Here, we show that, in some transformed lines, cadherin adhesion molecules exhibit a flow-like movement in a basal-apical direction at the cell junction and that this flow is associated with reorganizing actin filaments.
17057644 Surprisingly, the VE-cadherin-associated PAR protein complex lacks aPKC. Ectopic expression of VE-cadherin in epithelial cells affects tight junction formation.
16909109 Tyrosine phosphorylation mediated by Src kinase on cadherin 5 residue Tyr685 is a process that appears to be critical for vascular endothelial growth factor (VEGF)-induced endothelial cell migration.
16893970 Thus, VEC limits cell proliferation by retaining VEGFR-2 at the membrane and preventing its internalization into signaling compartments.
16481735 VE-cadherin and EphA2 act in a coordinated manner as a key regulatory element in the process of melanoma vasculogenic mimicry.
16322481 Cdc42 regulates AJ permeability by controlling the binding of alpha-catenin with beta-catenin and the consequent interaction of the VE-cadherin/catenin complex with the actin cytoskeleton.
16115630 Results suggest that in human umbilical vein endothelial cells Epac1 controls VE-cadherin-mediated cell junction formation and induces reorganization of the actin cytoskeleton.
16027153 A single phosphorylation event within the VE-cadherin cytoplasmic tail is sufficient to maintain cells in a mesenchymal state.
15980433 G alpha12 interaction with alphaSNAP induces VE-cadherin localization at endothelial junctions and regulates barrier function
15897346 upregulation of MIP-1beta and downregulation of VE-cadherin may strongly participate in human acute heart rejection.
15735710 promoter is subjected to bFGF induction, silencer elements may be located elsewhere in the gene
15731052 cleaved by Porphyromonas gingivalis gingipains in endothelial cells
15601837 cAMP-Epac-Rap1 signaling promotes decreased cell permeability by enhancing VE-cadherin-mediated adhesion lined by the rearranged cortical actin
15572031 VE-cadherin is involved in transendothelial migration of TCs, and replacement of DECs by TCs is not the result of apoptosis.
15374707 Serum VE-cadherin decreases significantly in both estradiol and raloxifene treated postmenopausal women.
15220112 Histamine interrupts cadherin adhesion and this effect on cadherin adhesion is independent of capacitive calcium flux.
14699141 interacts with p120 catenin to mediate cell locomotion and proliferation
14695457 elevated plasma levels in coronary artherossclerosis
14678493 the intracellular association of VE-cadherin with beta-catenin-linked cytoskeleton is essential to the maintenance of endothelial junctional integrity and microvascular permeability.
12740216 Modification by protein kinase C contributes to vascular endothelium barrier dysregulation induced by thrombin
12658549 Human Schlemm's canal cells express the endothelial adherens proteins, VE-cadherin and PECAM-1.
12626512 results provide new insights into the mechanisms of VE-cadherin processing and degradation in microvascular endothelial cells
12595527 VE-cadherin actively participates in inside-out signaling at the plasma membrane, leading to the development of endothelial membrane protrusions.
12584200 cleavage of VE cadherin by neutrophil surface-bound proteases induces formation of gaps through which neutrophils transmigrate
12413882 Data show that VE-cadherin and beta-catenin are only weakly associated with the actin-based cytoskeleton in cultured human vascular endothelial cells.
12393634 During transmigration of neutrophils through umbilical vein endothelium, VE-cadherin moved away to different ends of the transmigration site so that VE-cadherin-containing adherent junctions were relocated aside.
12243749 ADAM15 colocalizes with vascular endothelial (VE)-cadherin, which mediates endothelial cell adherens junction formation
12219009 tyrosine phosphorylation of VE cadherin is an important regulatory pathway associated with TNF-induced endothelial barrier dysfunction.
12095140 TNFalpha significantly increased permeability and induced p38 and ERK MAPK activation compared with controls (P < 0.05). These changes were associated with a loss of membrane-associated VE cadherin
12088286 Results show that P2X4 and P2X6 receptors are associated with VE-cadherin at HUVEC adherens junctions.
12010652 TNF-alpha affects VE-cadherin gene expression on the transcriptional level, inducing a downregulation of the VE-cadherin expression.
11950930 VEC may influence the constitutive organization of the actin cytoskeleton.
11937138 results suggest that the inadequate trophoblastic invasion, induced by antiphospholipid antibodies, can be the result of decreased alpha1 integrin and VE-cadherin and increased alpha5 integrin and E-cadherin expression in the trophoblast
11855855 An octapeptide in the juxtamembrane domain of VE-cadherin is important for p120ctn binding and cell proliferation.
11777950 Loss of vascular endothelial cadherin-mediated cell-cell adhesion increases the permeability of bone marrow endothelial cell monolayers and stimulates the transendothelial migration of CD34+ cells in response to stromal cell-derived factor-1 alpha.
11490021 Imaging studies of VE-cadherin in a flow model show neutrophil and monocyte transmigration occurring exclusively at the cell borders through formation of transient gaps in VE-cad distribution, as well as through preexisting gaps.

AA Sequence 

MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEKNTSLPHHVGK      1 - 70
IKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIK     71 - 140
VHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIIT    141 - 210
ITKSLDREKQARYEIVVEARDAQGLRGDSGTATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSL    211 - 280
FVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMS    281 - 350
PPAGNRAQVIINITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR    351 - 420
VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFAKPYQPKVCEN    421 - 490
AVHGQLVLQISAIDKDITPRNVKFKFILNTENNFTLTDNHDNTANITVKYGQFDREHTKVHFLPVVISDN    491 - 560
GMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQAVVAILLCILTITVITLLIFLRRRLRKQARA    561 - 630
HGKSVPEIHEQLVTYDEEGGGEMDTTSYDVSVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHG    631 - 700
GPGEMAAMIEVKKDEADHDGDGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKML    701 - 770
AELYGSDPREELLY                                                            771 - 784
//

Text Mined References (182)

PMID Year Title
26921435 2016 S-nitrosylation regulates VE-cadherin phosphorylation and internalization in microvascular permeability.
26728385 2016 [Preparation and application of monoclonal antibody against human vascular endothelial cadherin 5].
26681130 2016 Urinary trypsin inhibitor attenuates LPS-induced endothelial barrier dysfunction by upregulation of vascular endothelial-cadherin expression.
26663395 2016 Rab11a Mediates Vascular Endothelial-Cadherin Recycling and Controls Endothelial Barrier Function.
26598555 2016 VE-cadherin facilitates BMP-induced endothelial cell permeability and signaling.
26574545 2016 Ankyrin-G Inhibits Endocytosis of Cadherin Dimers.
26116572 2015 A local VE-cadherin and Trio-based signaling complex stabilizes endothelial junctions through Rac1.
25869066 2015 Girdin/GIV regulates transendothelial permeability by controlling VE-cadherin trafficking through the small GTPase, R-Ras.
25800053 2015 Intramembrane binding of VE-cadherin to VEGFR2 and VEGFR3 assembles the endothelial mechanosensory complex.
25746323 2015 Histone acetyltransferase p300 promotes MRTF-A-mediates transactivation of VE-cadherin gene in human umbilical vein endothelial cells.
25663699 2015 Local VE-cadherin mechanotransduction triggers long-ranged remodeling of endothelial monolayers.
25633318 2015 Tyrosine kinase receptor B protects against coronary artery disease and promotes adult vasculature integrity by regulating Ets1-mediated VE-cadherin expression.
25559184 2015 Rac1 functions as a reversible tension modulator to stabilize VE-cadherin trans-interaction.
25548487 2014 HIF-1? induces VE-cadherin expression and modulates vasculogenic mimicry in esophageal carcinoma cells.
25542764 2015 CD34+/CD144+ circulating endothelial cells as an indicator of carotid atherosclerosis.
25501813 2015 Segregation of VE-cadherin from the LBRC depends on the ectodomain sequence required for homophilic adhesion.
25443888 2014 Stromal cells attenuate the cytotoxicity of imatinib on Philadelphia chromosome-positive leukemia cells by up-regulating the VE-cadherin/?-catenin signal.
25422846 2014 Endothelial permeability and VE-cadherin: a wacky comradeship.
25362142 2015 Preeclampsia does not alter vascular growth and expression of CD31 and vascular endothelial cadherin in human placentas.
25361430 The impact of insulin treatment on the expression of vascular endothelial cadherin and Beta-catenin in human fetoplacental vessels.
25275457 2014 VE-cadherin-independent cancer cell incorporation into the vascular endothelium precedes transmigration.
25180771 2014 Different contributions of clathrin- and caveolae-mediated endocytosis of vascular endothelial cadherin to lipopolysaccharide-induced vascular hyperpermeability.
25147336 2014 Nucleoside diphosphate kinase B regulates angiogenesis through modulation of vascular endothelial growth factor receptor type 2 and endothelial adherens junction proteins.
24965294 2014 Soluble vascular endothelial-cadherin levels in patients with sepsis treated with direct hemoperfusion with a polymyxin B-immobilized fiber column.
24877096 2014 Elastase and cathepsin G from primed leukocytes cleave vascular endothelial cadherin in hemodialysis patients.
24820735 2014 CD144(+)EMPs/CD62E(+)EMPs: a couple of new biomarkers to monitor endothelial function in hypertension with hyperlipidemia involved.
24621569 2014 Dynamics between actin and the VE-cadherin/catenin complex: novel aspects of the ARP2/3 complex in regulation of endothelial junctions.
24603875 2014 Inter-cellular exchange of cellular components via VE-cadherin-dependent trans-endocytosis.
24498454 2014 Leptospira interrogans binds to cadherins.
24487320 2014 Leukocyte extravasation and vascular permeability are each controlled in vivo by different tyrosine residues of VE-cadherin.
24469639 2014 Increased serum levels of soluble vascular endothelial-cadherin in patients with systemic vasculitis.
24439748 2014 Exposing endothelial cells to tumor necrosis factor-? and peripheral blood mononuclear cells damage endothelial integrity via interleukin-1ß by degradation of vascular endothelial-cadherin.
24430214 Endothelial permeability and VE-cadherin: a wacky comradeship.
24227887 2014 ARP2/3-mediated junction-associated lamellipodia control VE-cadherin-based cell junction dynamics and maintain monolayer integrity.
24136461 2014 Novel mechanism regulating endothelial permeability via T-cadherin-dependent VE-cadherin phosphorylation and clathrin-mediated endocytosis.
24106276 2013 Transforming growth factor-?1 inhibits trophoblast cell invasion by inducing Snail-mediated down-regulation of vascular endothelial-cadherin protein.
24061286 2013 Auto-antibodies to vascular endothelial cadherin in humans: association with autoimmune diseases.
24046447 2013 eNOS-derived nitric oxide regulates endothelial barrier function through VE-cadherin and Rho GTPases.
24044891 2013 VE-cadherin and endothelial adherens junctions: active guardians of vascular integrity.
23918034 2014 Genome-wide association study (GWAS) for molar-incisor hypomineralization (MIH).
23887639 2013 Sirolimus-FKBP12.6 impairs endothelial barrier function through protein kinase C-? activation and disruption of the p120-vascular endothelial cadherin interaction.
23868598 2013 VE-cadherin status as an indicator of microvascular permeability.
23645533 2013 CDH5 is specifically activated in glioblastoma stemlike cells and contributes to vasculogenic mimicry induced by hypoxia.
23635392 2013 Vascular endothelial cadherin expression in lung specimens of patients with sepsis-induced acute respiratory distress syndrome and endothelial cell cultures.
23474739 2013 Decreased expression of VE-cadherin and claudin-5 and increased phosphorylation of VE-cadherin in vascular endothelium in nasal polyps.
23465821 2013 Human chorionic gonadotropin controls luteal vascular permeability via vascular endothelial growth factor by down-regulation of a cascade of adhesion proteins.
23376478 2013 Lycorine hydrochloride selectively inhibits human ovarian cancer cell proliferation and tumor neovascularization with very low toxicity.
23325790 2013 p120-catenin and ?-catenin differentially regulate cadherin adhesive function.
23288152 2013 Claudin-5 controls intercellular barriers of human dermal microvascular but not human umbilical vein endothelial cells.
23216791 2012 Interplay between neural-cadherin and vascular endothelial-cadherin in breast cancer progression.
23168683 2013 Urocortin increased LPS-induced endothelial permeability by regulating the cadherin-catenin complex via corticotrophin-releasing hormone receptor 2.
23159740 2012 VE-cadherin signaling induces EB3 phosphorylation to suppress microtubule growth and assemble adherens junctions.
23118492 2012 High-mobility group box-1 and endothelial cell angiogenic markers in the vitreous from patients with proliferative diabetic retinopathy.
23079531 2013 A targeted glycoproteomic approach identifies cadherin-5 as a novel biomarker of metastatic breast cancer.
23074279 2012 Antagonism of VEGF-A-induced increase in vascular permeability by an integrin ?3?1-Shp-1-cAMP/PKA pathway.
22975327 2012 The sphingosine-1-phosphate receptor S1PR1 restricts sprouting angiogenesis by regulating the interplay between VE-cadherin and VEGFR2.
22922959 2012 Intermedin: a novel regulator for vascular remodeling and tumor vessel normalization by regulating vascular endothelial-cadherin and extracellular signal-regulated kinase.
22865455 2012 CD133+ melanoma subpopulations contribute to perivascular niche morphogenesis and tumorigenicity through vasculogenic mimicry.
22833667 2012 Integrin ?2?1 mediates tyrosine phosphorylation of vascular endothelial cadherin induced by invasive breast cancer cells.
22734943 2013 Human mesenchymal stem cells inhibit endothelial proliferation and angiogenesis via cell-cell contact through modulation of the VE-Cadherin/?-catenin signaling pathway.
22720111 2012 Rickettsiae induce microvascular hyperpermeability via phosphorylation of VE-cadherins: evidence from atomic force microscopy and biochemical studies.
22648953 2012 p120-Catenin prevents neutrophil transmigration independently of RhoA inhibition by impairing Src dependent VE-cadherin phosphorylation.
22562824 2012 Hypoxia-induced vasculogenic mimicry formation via VE-cadherin regulation by Bcl-2.
22398721 2012 A VE-cadherin-PAR3-?-catenin complex regulates the Golgi localization and activity of cytosolic phospholipase A(2)? in endothelial cells.
22391038 2012 Vinculin associates with endothelial VE-cadherin junctions to control force-dependent remodeling.
22213015 2012 VE-cadherin trans-interactions modulate Rac activation and enhancement of lung endothelial barrier by iloprost.
22133903 2012 VE-Cadherin(low)?-smooth muscle actin+ component of vascular progenitor cells correlates with the coronary artery Gensini score.
22064597 2011 m-Calpain induction in vascular endothelial cells on human and mouse atheromas and its roles in VE-cadherin disorganization and atherosclerosis.
22040113 2011 Fusobacterium nucleatum adhesin FadA binds vascular endothelial cadherin and alters endothelial integrity.
21439626 2011 Hereditary angioedema: key role for kallikrein and bradykinin in vascular endothelial-cadherin cleavage and edema formation.
21269615 2011 Effect of GnRH agonist and hCG treatment on VEGF, angiopoietin-2, and VE-cadherin: trying to explain the link to ovarian hyperstimulation syndrome.
21269602 2011 Structure and binding mechanism of vascular endothelial cadherin: a divergent classical cadherin.
21190990 2011 Dentin matrix protein 1 induces membrane expression of VE-cadherin on endothelial cells and inhibits VEGF-induced angiogenesis by blocking VEGFR-2 phosphorylation.
21190742 2011 Monocyte trans-endothelial migration augments subsequent transmigratory activity with increased PECAM-1 and decreased VE-cadherin at endothelial junctions.
21168935 2011 Tyrosine phosphorylation of VE-cadherin and claudin-5 is associated with TGF-?1-induced permeability of centrally derived vascular endothelium.
20926024 Increased levels of soluble vascular endothelial cadherin are associated with poor outcome in severe sepsis.
20810734 2010 Andes virus disrupts the endothelial cell barrier by induction of vascular endothelial growth factor and downregulation of VE-cadherin.
20732872 2010 Cyclic AMP phosphodiesterase 4D (PDE4D) Tethers EPAC1 in a vascular endothelial cadherin (VE-Cad)-based signaling complex and controls cAMP-mediated vascular permeability.
20711993 2010 Definitive human and mouse hematopoiesis originates from the embryonic endothelium: a new class of HSCs based on VE-cadherin expression.
20693433 2010 VE-cadherin expression allows identification of a new class of hematopoietic stem cells within human embryonic liver.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20589320 2010 mRNA levels of CD31, CD144, CD146 and von Willebrand factor do not serve as surrogate markers for circulating endothelial cells.
20470859 2010 VE-cadherin and PECAM-1 enhance ALL migration across brain microvascular endothelial cell monolayers.
20463083 2010 Pathogenic hantaviruses Andes virus and Hantaan virus induce adherens junction disassembly by directing vascular endothelial cadherin internalization in human endothelial cells.
20446815 2011 Human mesenchymal stem cells inhibit vascular permeability by modulating vascular endothelial cadherin/?-catenin signaling.
20386594 2010 Retinoic acid mediates regulation of network formation by COUP-TFII and VE-cadherin expression by TGFbeta receptor kinase in breast cancer cells.
20332120 2010 CCM1 regulates vascular-lumen organization by inducing endothelial polarity.
20167365 2010 Differential expression of VE-cadherin and VEGFR2 in placental syncytiotrophoblast during preeclampsia - New perspectives to explain the pathophysiology.
20123970 2010 The motor protein myosin-X transports VE-cadherin along filopodia to allow the formation of early endothelial cell-cell contacts.
20123964 2010 Lipid phosphate phosphatase 3 stabilization of beta-catenin induces endothelial cell migration and formation of branching point structures.
20048167 2010 Src-induced tyrosine phosphorylation of VE-cadherin is not sufficient to decrease barrier function of endothelial monolayers.
20032304 2010 Vascular endothelial-cadherin stabilizes at cell-cell junctions by anchoring to circumferential actin bundles through alpha- and beta-catenins in cyclic AMP-Epac-Rap1 signal-activated endothelial cells.
19996314 2010 Cell-cell contact formation governs Ca2+ signaling by TRPC4 in the vascular endothelium: evidence for a regulatory TRPC4-beta-catenin interaction.
19915944 2010 Raised concentration of soluble form of vascular endothelial cadherin and IL-23 in sera of patients with Behçet's disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19760520 2010 The role of VE-cadherin in osteosarcoma cells.
19735546 2009 Effect of Genistein on vasculogenic mimicry formation by human uveal melanoma cells.
19633358 2009 The regulation of vascular endothelial growth factor-induced microvascular permeability requires Rac and reactive oxygen species.
19420236 2009 Endothelial barrier stabilization by a cyclic tandem peptide targeting VE-cadherin transinteraction in vitro and in vivo.
19356953 2009 Elevated tissue expression of thrombomodulatory factors correlates with acute symptomatic carotid plaque phenotype.
19345098 2009 VE-Cadherin-mediated cell-cell interaction suppresses sprouting via signaling to MLC2 phosphorylation.
19212436 2009 The integrin antagonist cilengitide activates alphaVbeta3, disrupts VE-cadherin localization at cell junctions and enhances permeability in endothelial cells.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19059243 2009 Breaking the VE-cadherin bonds.
18990449 2009 Biosynthesis and expression of VE-cadherin is regulated by the PI3K/mTOR signaling pathway.
18979298 2008 N-cadherin levels in endothelial cells are regulated by monolayer maturity and p120 availability.
18804209 2009 Increased levels of endothelial microparticles CD144 (VE-Cadherin) positives in type 2 diabetic patients with coronary noncalcified plaques evaluated by multidetector computed tomography (MDCT).
18662404 2008 The neurotransmitter dopamine modulates vascular permeability in the endothelium.
18641366 2008 p120-Catenin regulates leukocyte transmigration through an effect on VE-cadherin phosphorylation.
18639387 2008 Endothelial VE-cadherin expression in human lungs.
18628953 2008 Role of Sox-9, ER81 and VE-cadherin in retinoic acid-mediated trans-differentiation of breast cancer cells.
18420943 2008 ADAM10 regulates endothelial permeability and T-Cell transmigration by proteolysis of vascular endothelial cadherin.
18402976 2008 High-reproducible flow cytometric endothelial progenitor cell determination in human peripheral blood as CD34+/CD144+/CD3- lymphocyte sub-population.
18337748 2008 VE-cadherin is a critical endothelial regulator of TGF-beta signalling.
18316602 2008 Vascular endothelial cadherin promotes breast cancer progression via transforming growth factor beta signaling.
18287330 2008 VE-cadherin and beta-catenin binding dynamics during histamine-induced endothelial hyperpermeability.
18272754 2008 Peripheral blood mononuclear cells increase the permeability of dengue virus-infected endothelial cells in association with downregulation of vascular endothelial cadherin.
18195090 2008 Transcription factor Erg regulates angiogenesis and endothelial apoptosis through VE-cadherin.
18180305 2008 A novel role of vascular endothelial cadherin in modulating c-Src activation and downstream signaling of vascular endothelial growth factor.
18163230 Early response of endothelial cells to flow is mediated by VE-cadherin.
17761936 2007 Involvement of Rho kinase in endothelial barrier maintenance.
17638851 2007 Ph+/VE-cadherin+ identifies a stem cell like population of acute lymphoblastic leukemia sustained by bone marrow niche cells.
17194459 2007 Oxidized LDL specifically promotes the initiation of monocyte invasion during transendothelial migration with upregulated PECAM-1 and downregulated VE-cadherin on endothelial junctions.
17159998 2007 Basal-to-apical cadherin flow at cell junctions.
17060906 2006 VEGF controls endothelial-cell permeability by promoting the beta-arrestin-dependent endocytosis of VE-cadherin.
17057644 2006 A distinct PAR complex associates physically with VE-cadherin in vertebrate endothelial cells.
16909109 2007 Src kinase phosphorylates vascular endothelial-cadherin in response to vascular endothelial growth factor: identification of tyrosine 685 as the unique target site.
16893970 2006 Vascular endothelial cadherin controls VEGFR-2 internalization and signaling from intracellular compartments.
16481735 2006 VE-cadherin regulates EphA2 in aggressive melanoma cells through a novel signaling pathway: implications for vasculogenic mimicry.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16322481 2006 Cdc42 regulates adherens junction stability and endothelial permeability by inducing alpha-catenin interaction with the vascular endothelial cadherin complex.
16115630 2005 Epac1 regulates integrity of endothelial cell junctions through VE-cadherin.
16027153 2005 Tyrosine phosphorylation of VE-cadherin prevents binding of p120- and beta-catenin and maintains the cellular mesenchymal state.
15980433 2005 G alpha12 interaction with alphaSNAP induces VE-cadherin localization at endothelial junctions and regulates barrier function.
15897346 2005 Identification and characterization of two genes (MIP-1beta, VE-CADHERIN) implicated in acute rejection in human heart transplantation: use of murine models in tandem with cDNA arrays.
15861137 2005 Association of Csk to VE-cadherin and inhibition of cell proliferation.
15735710 2005 The human VE-cadherin promoter is subjected to organ-specific regulation and is activated in tumour angiogenesis.
15731052 2005 Gingipains from Porphyromonas gingivalis W83 induce cell adhesion molecule cleavage and apoptosis in endothelial cells.
15601837 2005 Cyclic AMP potentiates vascular endothelial cadherin-mediated cell-cell contact to enhance endothelial barrier function through an Epac-Rap1 signaling pathway.
15572031 2005 VE-cadherin is a critical molecule for trophoblast-endothelial cell interaction in decidual spiral arteries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15374707 2004 Effect of hormone therapy and raloxifene on serum VE-cadherin in postmenopausal women.
15220112 2004 Histamine selectively interrupts VE-cadherin adhesion independently of capacitive calcium entry.
14699141 2004 Laminar shear stress differentially modulates gene expression of p120 catenin, Kaiso transcription factor, and vascular endothelial cadherin in human coronary artery endothelial cells.
14695457 2004 Elevated concentration of soluble vascular endothelial cadherin is associated with coronary atherosclerosis.
14678493 2004 Transference of recombinant VE-cadherin cytoplasmic domain alters endothelial junctional integrity and porcine microvascular permeability.
12740216 2003 Protein kinase C modifications of VE-cadherin, p120, and beta-catenin contribute to endothelial barrier dysregulation induced by thrombin.
12658549 2002 Human Schlemm's canal cells express the endothelial adherens proteins, VE-cadherin and PECAM-1.
12626512 2003 Mechanisms of VE-cadherin processing and degradation in microvascular endothelial cells.
12595527 2003 VE-cadherin-induced Cdc42 signaling regulates formation of membrane protrusions in endothelial cells.
12584244 2003 Cadherin function probed by laser tweezer and single molecule fluorescence in vascular endothelial cells.
12584200 2003 Identification of proteases involved in the proteolysis of vascular endothelium cadherin during neutrophil transmigration.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426320 2003 The Armadillo family protein p0071 is a VE-cadherin- and desmoplakin-binding protein.
12413882 2002 Dynamics of vascular endothelial-cadherin and beta-catenin localization by vascular endothelial growth factor-induced angiogenesis in human umbilical vein cells.
12393634 2002 Differential movements of VE-cadherin and PECAM-1 during transmigration of polymorphonuclear leukocytes through human umbilical vein endothelium.
12243749 2002 ADAM15 is an adherens junction molecule whose surface expression can be driven by VE-cadherin.
12234928 2002 VE-PTP and VE-cadherin ectodomains interact to facilitate regulation of phosphorylation and cell contacts.
12219009 2002 Tyrosine phosphorylation of vascular endothelial cadherin and the regulation of microvascular permeability.
12130501 2002 A monoclonal antibody to vascular endothelial-cadherin inhibits tumor angiogenesis without side effects on endothelial permeability.
12095140 2002 The role of p38 map kinase in tumor necrosis factor-induced redistribution of vascular endothelial cadherin and increased endothelial permeability.
12088286 2002 P2X4 and P2X6 receptors associate with VE-cadherin in human endothelial cells.
12010652 2002 The tumour necrosis factor-alpha induced vascular permeability is associated with a reduction of VE-cadherin expression.
12003790 2002 Histamine stimulates phosphorylation of adherens junction proteins and alters their link to vimentin.
11950930 2002 VE-cadherin regulates endothelial actin activating Rac and increasing membrane association of Tiam.
11950700 2002 Vascular endothelial growth factor induces SHC association with vascular endothelial cadherin: a potential feedback mechanism to control vascular endothelial growth factor receptor-2 signaling.
11937138 2002 Antiphospholid antibodies regulate the expression of trophoblast cell adhesion molecules.
11900554 2002 Interaction of fibrin(ogen) with the endothelial cell receptor VE-cadherin: mapping of the receptor-binding site in the NH2-terminal portions of the fibrin beta chains.
11855855 2002 An octapeptide in the juxtamembrane domain of VE-cadherin is important for p120ctn binding and cell proliferation.
11490021 2001 Real-time imaging of vascular endothelial-cadherin during leukocyte transmigration across endothelium.
10861224 2000 Identification of three human type-II classic cadherins and frequent heterophilic interactions between different subclasses of type-II classic cadherins.
10681592 2000 SHP2 association with VE-cadherin complexes in human endothelial cells is regulated by thrombin.
10428027 1999 Targeted deficiency or cytosolic truncation of the VE-cadherin gene in mice impairs VEGF-mediated endothelial survival and angiogenesis.
10063232 1998 An immunohistochemical study of cadherin 5 (VE-cadherin) in vascular endothelial cells in placentas with gestosis.
9739078 1998 VE-cadherin and desmoplakin are assembled into dermal microvascular endothelial intercellular junctions: a pivotal role for plakoglobin in the recruitment of desmoplakin to intercellular junctions.
9615235 1998 Localization of human cadherin genes to chromosome regions exhibiting cancer-related loss of heterozygosity.
9378757 1997 Cell confluence regulates tyrosine phosphorylation of adherens junction components in endothelial cells.
9219219 1997 Vascular endothelial cadherin (VE-cadherin): cloning and role in endothelial cell-cell adhesion.
7806582 1994 E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.
7627717 1995 Functional properties of human vascular endothelial cadherin (7B4/cadherin-5), an endothelium-specific cadherin.
2059658 1991 Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue.
1522121 1992 A novel endothelial-specific membrane protein is a marker of cell-cell contacts.