Property Summary

NCBI Gene PubMed Count 36
PubMed Score 91.20
PubTator Score 70.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Obesity 616
Disease Target Count P-value
psoriasis 6685 2.2e-82
malignant mesothelioma 3163 6.6e-07
medulloblastoma, large-cell 6234 8.5e-06
cystic fibrosis 1670 1.4e-05
group 3 medulloblastoma 2254 6.3e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0
Heart disease 279 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -2.000 6.6e-07
cystic fibrosis 2.624 1.4e-05
medulloblastoma, large-cell -2.100 8.5e-06
group 3 medulloblastoma -1.700 6.3e-03
psoriasis -2.500 2.2e-82

Protein-protein Interaction (3)

Gene RIF (11)

PMID Text
24429027 P-cadherin expression correlated with tumor progression and could be an independent predictor for bladder cancer survival.
22820501 R-cadherin adherens junction formation facilitates a mesenchymal to epithelial-like transition in MDA-MB-231 cells.
22219182 Findings identify an important role of CHD4 in controlling homologous recombination repair to maintain genome stability and establish the potential therapeutic implications of targeting CHD4 deficiency in tumors.
21665361 a novel putative tumor suppressor gene that can be frequently and tumor-specifically inactivated by its promoter methylation in nasopharyngeal carcinoma
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
16786001 the degradation of E-cadherin in response to expression of R-cadherin is due to competition for p120(ctn)
15548679 CDH4 may act as a tumor suppressor gene in human gastrointestinal tumors and can potentially be used as an early diagnostic marker for gastrointestinal tumorigenesis
15143071 R-cadherin induces cell motility when expressed in epithelial cells, and this increased motility is dependent upon Rho GTPase activity.

AA Sequence

MTAGAGVLLLLLSLSGALRAHNEDLTTRETCKAGFSEDDYTALISQNILEGEKLLQVKFSSCVGTKGTQY      1 - 70
ETNSMDFKVGADGTVFATRELQVPSEQVAFTVTAWDSQTAEKWDAVVRLLVAQTSSPHSGHKPQKGKKVV     71 - 140
ALDPSPPPKDTLLPWPQHQNANGLRRRKRDWVIPPINVPENSRGPFPQQLVRIRSDKDNDIPIRYSITGV    141 - 210
GADQPPMEVFSIDSMSGRMYVTRPMDREEHASYHLRAHAVDMNGNKVENPIDLYIYVIDMNDNRPEFINQ    211 - 280
VYNGSVDEGSKPGTYVMTVTANDADDSTTANGMVRYRIVTQTPQSPSQNMFTINSETGDIVTVAAGLDRE    281 - 350
KVQQYTVIVQATDMEGNLNYGLSNTATAIITVTDVNDNPPEFTASTFAGEVPENRVETVVANLTVMDRDQ    351 - 420
PHSPNWNAVYRIISGDPSGHFSVRTDPVTNEGMVTVVKAVDYELNRAFMLTVMVSNQAPLASGIQMSFQS    421 - 490
TAGVTISIMDINEAPYFPSNHKLIRLEEGVPPGTVLTTFSAVDPDRFMQQAVRYSKLSDPASWLHINATN    491 - 560
GQITTAAVLDRESLYTKNNVYEATFLAADNGIPPASGTGTLQIYLIDINDNAPELLPKEAQICEKPNLNA    561 - 630
INITAADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPL    631 - 700
SNTSIIKVKVCPCDDNGDCTTIGAVAAAGLGTGAIVAILICILILLTMVLLFVMWMKRREKERHTKQLLI    701 - 770
DPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPEAMGHVPSKAPGVRRVDERPVGAEPQYPIRPMVPHPG    771 - 840
DIGDFINEGLRAADNDPTAPPYDSLLVFDYEGSGSTAGSVSSLNSSSSGDQDYDYLNDWGPRFKKLADMY    841 - 910
GGGEED                                                                    911 - 916
//

Text Mined References (36)

PMID Year Title
24429027 2014 The prognostic value of P-cadherin in non-muscle-invasive bladder cancer.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23279374 2013 Genetic determinants of plasma ??-glycoprotein I levels: a genome-wide association study in extended pedigrees from Spain.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22820501 2012 Small GTPase Rho regulates R-cadherin through Dia1/profilin-1.
22219182 2012 Chromodomain helicase DNA-binding protein 4 (CHD4) regulates homologous recombination DNA repair, and its deficiency sensitizes cells to poly(ADP-ribose) polymerase (PARP) inhibitor treatment.
21665361 2011 CDH4 as a novel putative tumor suppressor gene epigenetically silenced by promoter hypermethylation in nasopharyngeal carcinoma.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
20932310 2010 Genome-wide association reveals genetic effects on human A?42 and ? protein levels in cerebrospinal fluids: a case control study.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17903297 2007 Genetic correlates of brain aging on MRI and cognitive test measures: a genome-wide association and linkage analysis in the Framingham Study.
16786001 2006 Expression of inappropriate cadherins by epithelial tumor cells promotes endocytosis and degradation of E-cadherin via competition for p120(ctn).
15548679 2004 Frequent aberrant methylation of the CDH4 gene promoter in human colorectal and gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15143071 2004 R-cadherin influences cell motility via Rho family GTPases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10799302 2000 Mutation analysis of cadherin-4 reveals amino acid residues of EC1 important for the structure and function.
10760957 2000 Differential regulation of cadherins by dexamethasone in human osteoblastic cells.
10662782 2000 Functional cis-heterodimers of N- and R-cadherins.
10516427 1999 Assignment of cadherin-4 (R-cadherin, CDH4) to human chromosome band 20q13.3.
10191097 1999 Mapping of a cadherin gene cluster to a region of chromosome 5 subject to frequent allelic loss in carcinoma.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7982033 1994 Cloning of five human cadherins clarifies characteristic features of cadherin extracellular domain and provides further evidence for two structurally different types of cadherin.
7806582 1994 E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.
2059658 1991 Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue.
798233 [Relations between social defense and criminological trends from the 1930s until today].