Property Summary

NCBI Gene PubMed Count 97
PubMed Score 264.80
PubTator Score 150.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
interstitial lung disease 2.400 2.2e-03
malignant mesothelioma 1.300 2.1e-06
psoriasis 1.900 2.0e-100
cutaneous lupus erythematosus 1.100 2.3e-02
atypical teratoid/rhabdoid tumor 1.800 1.5e-03
Atopic dermatitis 1.800 4.0e-04
primary pancreatic ductal adenocarcinoma 1.457 3.9e-02
non-small cell lung cancer 3.165 1.4e-23
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-02
colon cancer 4.100 1.6e-07
active Crohn's disease 1.512 3.1e-03
active ulcerative colitis 4.118 8.0e-03
pancreatic cancer 2.000 2.9e-06
lung adenocarcinoma 1.800 1.4e-11
group 4 medulloblastoma 1.100 9.6e-04
pilocytic astrocytoma 1.600 1.7e-05
Breast cancer -1.600 2.2e-04
ovarian cancer -1.500 1.6e-04

 GO Function (1)

 CSPA Cell Line (1)

Protein-protein Interaction (3)

Gene RIF (65)

PMID Text
26299056 In patients with breast infiltrating ductal carcinoma, P-cadherin was expressed in 40.5% of cases; P-cadherin expression had a negative relationship with the overall survival
25849494 The P-cadherin structure and packing arrangement provide new and valuable information towards the complete structural characterization of the cadherin dimerization pathway.
25337260 Downregulation of P-cadherin expression appears to induce tumorigenicity in hepatocellular carcinoma.
25322858 P-cadherin is able to potentiate ligand-dependent signaling of insulin-like growth factor 1 receptor in malignant keratinocytes and epidermal growth factor receptor in dysplastic cells.
25269858 results establish a link between aberrant P-cadherin expression and hypoxic, glycolytic and acid-resistant breast cancer cells, suggesting a possible role for this marker in cancer cell metabolism
25023983 These findings indicate that HOXA9 contributes to poor outcomes in Epithelial ovarian cancer in part by promoting intraperitoneal dissemination via its induction of P-cadherin.
24636838 Positive N-cadherin and P-cadherin expression closely correlated with clinicopathological and biological behaviors, and poor-prognosis of gallbladder cancer.
24559158 The X-dimer plays a key role in the specific cell-cell adhesion mediated by human P-cadherin.
24139214 P-cadherin and vimentin could be adjunctive to the commonly used immunohistochemical surrogates for basal-like breast cancer identification
23740836 Loss of P-cadherin expression is associated with oral squamous cell carcinoma.
23682078 Increased expression of CDH3 is associated with colorectal cancer.
23405208 High CDH3 expression is associated with aggressive breast tumour behaviour.
23398382 The expression of n-cadherin is increased while the p-caherin expression is decreased in patients with Leydig cell tumors.
23334344 P-cadherin-mediated signaling is a melanocyte subtype-specific topobiological regulator of normal human pigmentation, possibly via GSK3beta-mediated canonical Wnt signaling.
23180380 Results show a role for E- and P-cadherin co-expression in breast cancer progression and highlight the potential benefit of targeting P-cadherin in the aggressive tumours expressing high levels of this protein.
23143461 Hypotrichosis associated with juvenile macular dystrophy is caused by mutations in CDH3, which encodes P-cadherin, a member of the classic cadherin family.
22696062 P-cadherin regulates human hair growth and cycling via canonical Wnt signaling and transforming growth factor-beta2.
22531681 LA carcinomas and carcinomas negative for basal markers were more often negative for epithelial cell adhesion molecule (Ep-CAM) and P-cadherin
22389315 P-cadherin is coexpressed with CD44 and CD49f and mediates stem cell properties in basal-like breast cancer.
22348569 A novel nonsense CDH3 mutation in hypotrichosis with juvenile macular dystrophy
22209340 Compared with conventional carcinomas, serrated adenocarcinomas showed no significant difference in P-cadherin staining.
21781454 Expression of E-cadherin is downregulated, and expression of P-cadherin is upregulated in oral mucosa of mucous membrane pemphigoid (MMP), which may be involved in the pathogenesis of MMP.
21703417 High P-cadherin promotes liver metastasis and is associated with colon cancer.
21317933 P-cadherin cooperates with insulin-like growth factor-1 receptor to promote metastatic signaling of gonadotropin-releasing hormone in ovarian cancer via p120 catenin.
20860798 Data conclude that P-cadherin counteracts the expression and function of myosin II-B, resulting in the suppression of the invasive and migratory behaviour of BLM melanoma cells.
20852590 P-cadherin positivity is associated with high-grade breast cancer subtypes and well-established markers of poor prognosis.
20844743 Observational study of gene-disease association. (HuGE Navigator)
20668551 Data indicate that P-cadherin but not E-cadherin is important for maintaining adherens junctions in DU145 and MCF10A cells.
20621328 P-cadherin and CD24 are expressed in carcinomas of the biliary tract with high frequency and at an early stage of carcinogenesis.
20473917 Stable knockdown of P-cadherin in RT-112 cells diminished invasion and migration, and promoted intercellular adhesion
20385540 C/EBPbeta is able to up-regulate CDH3 promoter activity in breast cancer cells; the expression of P-cadherin linked with a worse prognosis of breast cancer patients
20338046 We investigated methylation patterns in the promoter regions of ABCB1, ATM, BRCA1, CDH3, CDKN2A, CXCR4, ESR1, FBXW7, FOXC1, GSTP1, IGF2, HMLH1, PPP2R2B, and PTEN75 in well-described pre-treatment samples from locally advanced breast cancer
20204300 P-cadherin gene expression proved to be a significant independent prognostic factor for both cancer-specific and recurrence-free survival in bladder cancer
20203473 2 splice site mutations (one novel and one recurrent mutation) were in the CDH3 gene leading to hypotrichosis with juvenile macular dystrophy.
20140736 a novel splice site mutation (c.IVS10-1 G --> A) in intron 10, which leads to skipping of exon 11 in CDH3 gene in family with hypotrichosis with juvenile macular dystrophy
20118984 cadherin switching and p120(ctn) signaling as important targets of GnRH function and as novel mediators of invasiveness and tumor progression in ovarian cancer.
19915572 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19901964 Data show that P-cadherin overexpression in breast cancer cells with wild-type E-cadherin promotes cell invasion, motility, and induces the secretion of MMP-1 and MMP-2, which then lead to P-cadherin ectodomain cleavage.
19882246 Overexpression of CDH3 is associated with basal-like phenotype in breast cancer.
19846933 Demethylation of the CDH3 gene was detected in 25 out of the 36 (69%) primary gastric carcinomas, suggesting that the aberrant demethylation of CDH3 is a frequent event in gastric carcinomas.
19528483 Aberrant demethylation of CDH3 is associated with colorectal carcinomas.
19469909 EGFR, fibrillin-2, P-cadherin and AP2beta as biomarkers for rhabdomyosarcoma diagnostics.
19076794 The identified mutation IVS10-1 G-->T is very likely to result in skipping of exon 11, leading either to synthesis of truncated protein or to an absence of CDH3 expression, possibly due to mRNA decay.
19043399 Expression of CD24, P-cadherin and S100A4 in tumors of the ampulla of Vater.
18927288 Up-regulation of CDH3 is associated with pancreatic, gastric, and colorectal cancers.
18829530 Induced P-cadherin expression, especially in mucosal damage, leads to an increased rate of crypt fission, a common feature of clonal expansion in gastrointestinal dysplasia.
18811693 High levels of the soluble fragment of P-cadherin in Cancer Nipple aspirate fluid suggest its possible release via proteolytic processing
18637128 The expression of P-cadherin (a marker of proliferating keratinocytes) was regulated by all of the examined PKCs, also in an antagonistic manner (inhibited by cPKCalpha/nPKCdelta and stimulated by cPKCbeta/nPKCepsilon).
18637117 Results suggest that generation of truncated P-cadherin during the progression of oral squamous carcinoma attenuates tissue integrity, facilitates cellular separation, and leads to the acquisition of a more migratory phenotype.
18330089 P-cadherin expression in adenomas suggest that this molecule might have role in adenoma formation though not necessarily be involved in neoplastic progression.
18329483 This preliminary study provides evidence that the CK19/EpCAM2 and/or CK19/P-cadherin ratio(s) may be a simple and accurate prognostic indicator of clinical outcome in early-stage adenocarcinoma of the lung.
18230143 Tunisian IBCs are characterized by frequent basal and ERBB2 phenotypes. Surprisingly, luminal inflammatory breast cancer also express the basal marker P-cadherin.
18199584 P-cadherin is a newly defined transcriptional target gene of p63, with a crucial role in hair follicle morphogenesis as well as the apical ectodermal ridge during limb bud outgrowth in humans.
18074863 P-cadherin may be regarded as an additional immunohistochemical marker of basal-like breast carcinomas.
17342797 Novel heterozygous CDH3 mutations in hypotrichosis with juvenile macular dystrophy in two nonconsaguineous families.
16115928 P-cadherin expression was strongly associated with tumor aggressiveness, being a good indicator of clinical outcome, and the aberrant expression of P-cadherin in breast cancer might be regulated by gene promoter hypomethylation.
15967043 P-cadherin may have a role in progression of oral squamous cell carcinoma
15817166 A short truncated 50 kDa form of the N-terminal part of P-cadherin expresses in melanoma cell lines compared to melanocytes and keratinocytes.
15805154 In summary, we have ascertained a third gene associated with ectrodactyly and have demonstrated a hitherto unrecognised role of CDH3 in shaping the human hand
15375751 An absent P-cadherin expression could constitute a hallmark of aggressive biological behaviour in oral squamous cell carcinoma.
12919105 Inappropriate PCAD expression in mouse mammary epithelium is compatible with normal mammary gland function.
12800191 Regulated expression of P-cadherin/beta-catenin complexes in ovarian tumor cells may represent a key step in disease progression
12112590 may play a central role in the development of endometriosis by mediating endometrial-peritoneal cell interactions in a homophilic manner
12021924 results point to the close relationship between the de novo expression of P-cadherin and the disruption of the cadherin/catenins complex with the squamoid phenotype of mucoepidermoid carcinoma of the thyroid (MECT)
11891861 high levels of 80 kDa sP-cadherin in human milk.

AA Sequence

MGLPRGPLASLLLLQVCWLQCAASEPCRAVFREAEVTLEAGGAEQEPGQALGKVFMGCPGQEPALFSTDN      1 - 70
DDFTVRNGETVQERRSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTK     71 - 140
IFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQND    141 - 210
HKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTIS    211 - 280
VISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLT    281 - 350
VTDLDAPNSPAWRATYLIMGGDDGDHFTITTHPESNQGILTTRKGLDFEAKNQHTLYVEVTNEAPFVLKL    351 - 420
PTSTATIVVHVEDVNEAPVFVPPSKVVEVQEGIPTGEPVCVYTAEDPDKENQKISYRILRDPAGWLAMDP    421 - 490
DSGQVTAVGTLDREDEQFVRNNIYEVMVLAMDNGSPPTTGTGTLLLTLIDVNDHGPVPEPRQITICNQSP    491 - 560
VRQVLNITDKDLSPHTSPFQAQLTDDSDIYWTAEVNEEGDTVVLSLKKFLKQDTYDVHLSLSDHGNKEQL    561 - 630
TVIRATVCDCHGHVETCPGPWKGGFILPVLGAVLALLFLLLVLLLLVRKKRKIKEPLLLPEDDTRDNVFY    631 - 700
YGEEGGGEEDQDYDITQLHRGLEARPEVVLRNDVAPTIIPTPMYRPRPANPDEIGNFIIENLKAANTDPT    701 - 770
APPYDTLLVFDYEGSGSDAASLSSLTSSASDQDQDYDYLNEWGSRFKKLADMYGGGEDD               771 - 829
//

Text Mined References (100)

PMID Year Title
26299056 2015 [Cadherins E and P expression in the molecular types of breast cancer].
25849494 2015 The X-ray structure of human P-cadherin EC1-EC2 in a closed conformation provides insight into the type I cadherin dimerization pathway.
25337260 2014 Downregulation of P-cadherin expression in hepatocellular carcinoma induces tumorigenicity.
25322858 2014 P-cadherin potentiates ligand-dependent EGFR and IGF-1R signaling in dysplastic and malignant oral keratinocytes.
25269858 2014 The basal epithelial marker P-cadherin associates with breast cancer cell populations harboring a glycolytic and acid-resistant phenotype.
25023983 2014 HOXA9 promotes homotypic and heterotypic cell interactions that facilitate ovarian cancer dissemination via its induction of P-cadherin.
24636838 2014 N-cadherin and P-cadherin are biomarkers for invasion, metastasis, and poor prognosis of gallbladder carcinomas.
24559158 2014 Identification and characterization of the X-dimer of human P-cadherin: implications for homophilic cell adhesion.
24139214 2013 P-cadherin and vimentin are useful basal markers in breast cancers.
23740836 2013 Presenilin 1/?-secretase modulates P-cadherin processing and influences cell adhesion in oral squamous cell carcinoma cell lines.
23682078 2013 Identification of putative immunologic targets for colon cancer prevention based on conserved gene upregulation from preinvasive to malignant lesions.
23405208 2013 CCAAT/enhancer binding protein ? (C/EBP?) isoforms as transcriptional regulators of the pro-invasive CDH3/P-cadherin gene in human breast cancer cells.
23398382 2013 Switch of cadherin expression as a diagnostic tool for Leydig cell tumours.
23334344 2013 Topobiology of human pigmentation: P-cadherin selectively stimulates hair follicle melanogenesis.
23180380 2013 P-cadherin functional role is dependent on E-cadherin cellular context: a proof of concept using the breast cancer model.
23143461 2012 Homozygous deletion in CDH3 and hypotrichosis with juvenile macular dystrophy.
22696062 2012 P-cadherin regulates human hair growth and cycling via canonical Wnt signaling and transforming growth factor-?2.
22613680 2012 Epithelial E- and P-cadherins: role and clinical significance in cancer.
22531681 2012 Relationships between immunophenotype, Ki-67 index, microvascular density, Ep-CAM/P-cadherin, and MMP-2 expression in early-stage invasive ductal breast cancer.
22389315 2012 P-cadherin is coexpressed with CD44 and CD49f and mediates stem cell properties in basal-like breast cancer.
22348569 2012 A novel nonsense CDH3 mutation in hypotrichosis with juvenile macular dystrophy.
22209340 2012 Immunohistochemical expression profile of ?-catenin, E-cadherin, P-cadherin, laminin-5?2 chain, and SMAD4 in colorectal serrated adenocarcinoma.
21781454 Reciprocal altered expression of E-cadherin and P-cadherin in mucous membrane pemphigoid.
21703417 2011 P-cadherin promotes liver metastasis and is associated with poor prognosis in colon cancer.
21317933 2011 P-cadherin cooperates with insulin-like growth factor-1 receptor to promote metastatic signaling of gonadotropin-releasing hormone in ovarian cancer via p120 catenin.
21269460 2011 Initial characterization of the human central proteome.
20860798 2010 P-cadherin counteracts myosin II-B function: implications in melanoma progression.
20852590 2011 P-cadherin expression as a prognostic biomarker in a 3992 case tissue microarray series of breast cancer.
20844743 2010 Single nucleotide polymorphisms in the Wnt and BMP pathways and colorectal cancer risk in a Spanish cohort.
20668551 2010 p120ctn and P-cadherin but not E-cadherin regulate cell motility and invasion of DU145 prostate cancer cells.
20621328 2010 Cell adhesion molecules P-cadherin and CD24 are markers for carcinoma and dysplasia in the biliary tract.
20473917 2011 P-cadherin in adhesion and invasion: opposite roles in colon and bladder carcinoma.
20385540 2010 ICI 182,780 induces P-cadherin overexpression in breast cancer cells through chromatin remodelling at the promoter level: a role for C/EBPbeta in CDH3 gene activation.
20338046 2010 DNA methylation profiling in doxorubicin treated primary locally advanced breast tumours identifies novel genes associated with survival and treatment response.
20204300 2010 The prognostic value of cadherin switch in bladder cancer.
20203473 2010 Splice site mutations in the P-cadherin gene underlie hypotrichosis with juvenile macular dystrophy.
20140736 2010 A novel splice-acceptor site mutation in CDH3 gene in a consanguineous family exhibiting hypotrichosis with juvenile macular dystrophy.
20118984 2010 Cadherin switching and activation of p120 catenin signaling are mediators of gonadotropin-releasing hormone to promote tumor cell migration and invasion in ovarian cancer.
19915572 2009 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region.
19901964 2010 Extracellular cleavage and shedding of P-cadherin: a mechanism underlying the invasive behaviour of breast cancer cells.
19882246 2010 BRCA1 transcriptionally regulates genes associated with the basal-like phenotype in breast cancer.
19846933 2009 Frequent CDH3 demethylation in advanced gastric carcinoma.
19528483 2009 Demethylation of the CDH3 gene is frequently detected in advanced colorectal cancer.
19469909 2009 Immunohistochemical detection of EGFR, fibrillin-2, P-cadherin and AP2beta as biomarkers for rhabdomyosarcoma diagnostics.
19076794 2009 A novel splice-site mutation in the CDH3 gene in hypotrichosis with juvenile macular dystrophy.
19043399 2009 Expression of CD24, P-cadherin and S100A4 in tumors of the ampulla of Vater.
18927288 2008 Identification of a novel tumor-associated antigen, cadherin 3/P-cadherin, as a possible target for immunotherapy of pancreatic, gastric, and colorectal cancers.
18829530 2008 Ectopic expression of P-cadherin correlates with promoter hypomethylation early in colorectal carcinogenesis and enhanced intestinal crypt fission in vivo.
18811693 2008 Increased shedding of soluble fragments of P-cadherin in nipple aspirate fluids from women with breast cancer.
18637128 2009 Protein kinase C isoenzymes differentially regulate the differentiation-dependent expression of adhesion molecules in human epidermal keratinocytes.
18637117 2008 Truncated P-cadherin is produced in oral squamous cell carcinoma.
18330089 The significance of beta-catenin, E-cadherin, and P-cadherin expressions in neoplastic progression of colorectal mucosa: an immunohistochemical study.
18329483 2008 A simple two-gene prognostic model for adenocarcinoma of the lung.
18230143 2008 Markers of subtypes in inflammatory breast cancer studied by immunohistochemistry: prominent expression of P-cadherin.
18199584 2008 P-cadherin is a p63 target gene with a crucial role in the developing human limb bud and hair follicle.
18074863 2007 Relationship of P-cadherin expression to basal phenotype of breast carcinoma.
17342797 2007 Novel CDH3 mutations in hypotrichosis with juvenile macular dystrophy.
17052462 2006 Crystal structure of a beta-catenin/BCL9/Tcf4 complex.
16115928 2005 P-cadherin overexpression is an indicator of clinical outcome in invasive breast carcinomas and is associated with CDH3 promoter hypomethylation.
16007225 2005 Adhesion signaling by a novel mitotic substrate of src kinases.
15967043 2005 P-cadherin expression and survival rate in oral squamous cell carcinoma: an immunohistochemical study.
15817166 2005 A secreted form of P-cadherin is expressed in malignant melanoma.
15805154 2005 Distinct CDH3 mutations cause ectodermal dysplasia, ectrodactyly, macular dystrophy (EEM syndrome).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15375751 2004 P-cadherin expression predicts clinical outcome in oral squamous cell carcinomas.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12919105 2003 Inappropriate P-cadherin expression in the mouse mammary epithelium is compatible with normal mammary gland function.
12876286 2003 CHOP transcription factor phosphorylation by casein kinase 2 inhibits transcriptional activation.
12800191 2003 Cadherin switching in ovarian cancer progression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445216 2002 A missense mutation in CDH3, encoding P-cadherin, causes hypotrichosis with juvenile macular dystrophy.
12417987 2002 A missense mutation (R565W) in cirhin (FLJ14728) in North American Indian childhood cirrhosis.
12112590 2002 Identification of the cadherin subtypes present in the human peritoneum and endometriotic lesions: potential role for P-cadherin in the development of endometriosis.
12021924 2002 Mucoepidermoid carcinoma of the thyroid: a tumour histotype characterised by P-cadherin neoexpression and marked abnormalities of E-cadherin/catenins complex.
11909859 2002 Analysis of heterophilic and homophilic interactions of cadherins using the c-Jun/c-Fos dimerization domains.
11889072 2002 Aberrant P-cadherin expression is an early event in hyperplastic and dysplastic transformation in the colon.
11544476 2001 Hypotrichosis with juvenile macular dystrophy is caused by a mutation in CDH3, encoding P-cadherin.
11401672 2001 Upregulation of P-cadherin expression in the lesional skin of pemphigus, Hailey-Hailey disease and Darier's disease.
11106563 2000 Role of nephrin in cell junction formation in human nephrogenesis.
11066045 2000 Cadherin expression in glandular tumors of the cervix.
10655458 2000 Expression of cadherin adhesion molecules on human gametes.
10460003 1999 Cadherin and catenin expression in normal human bronchial epithelium and non-small cell lung cancer.
10381631 1999 The fate of E- and P-cadherin during the early stages of apoptosis.
9815605 1997 P-Cadherin is a basal cell-specific epithelial marker that is not expressed in prostate cancer.
9615235 1998 Localization of human cadherin genes to chromosome regions exhibiting cancer-related loss of heterozygosity.
9359492 1997 Human squamous-cell-carcinoma cell line (DJM-1) cells synthesize P-cadherin molecules via an elevation of extracellular calcium: calcium regulates P-cadherin-gene expression at the translational level via protein tyrosine phosphorylation.
9250159 1997 Expression of P-cadherin identifies prostate-specific-antigen-negative cells in epithelial tissues of male sexual accessory organs and in prostatic carcinomas. Implications for prostate cancer biology.
8660921 1996 The novel catenin p120cas binds classical cadherins and induces an unusual morphological phenotype in NIH3T3 fibroblasts.
8227214 1993 Expression of E- or P-cadherin is not sufficient to modify the morphology and the tumorigenic behavior of murine spindle carcinoma cells. Possible involvement of plakoglobin.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8074995 1994 Spatiotemporal expression of molecules associated with junctional complexes during the in vivo maturation of renal podocytes.
8056851 1994 E-cadherin is the major mediator of human melanocyte adhesion to keratinocytes in vitro.
7806582 1994 E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.
7538474 1995 Expression of cadherins and integrins in human endometrium throughout the menstrual cycle.
7534041 1995 Anomalous expression of P-cadherin in breast carcinoma. Correlation with E-cadherin expression and pathological features.
2793940 1989 Molecular cloning of a human Ca2+-dependent cell-cell adhesion molecule homologous to mouse placental cadherin: its low expression in human placental tissues.
2702654 1989 Cadherin cell-adhesion molecules in human epithelial tissues and carcinomas.
1924379 1991 The uvomorulin-anchorage protein alpha catenin is a vinculin homologue.
1427864 1992 The gene for the cell adhesion molecule M-cadherin maps to mouse chromosome 8 and human chromosome 16q24.1-qter and is near the E-cadherin (uvomorulin) locus in both species.