Property Summary

NCBI Gene PubMed Count 7
PubMed Score 11.73
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 4.4e-166
nasopharyngeal carcinoma 1056 1.1e-09
osteosarcoma 7933 3.9e-05
uncontrolled asthma 67 7.0e-04
rhinitis with controlled asthma 8 3.3e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Eosinophilic esophagitis 31 3.274 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
rhinitis with controlled asthma 1.200 3.3e-02
uncontrolled asthma 2.200 7.0e-04
osteosarcoma -1.230 3.9e-05
psoriasis 2.700 4.4e-166
nasopharyngeal carcinoma -2.600 1.1e-09

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19824886 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)

AA Sequence

MAMRSGRHPSLLLLLVLLLWLLQVSIIDSVQQETDDLTKQTKEKIYQPLRRSKRRWVITTLELEEEDPGP      1 - 70
FPKLIGELFNNMSYNMSLMYLISGPGVDEYPEIGLFSLEDHENGRIYVHRPVDREMTPSFTVYFDVVERS     71 - 140
TGKIVDTSLIFNIRISDVNDHAPQFPEKEFNITVQENQSAGQPIFQMLAVDLDEENTPNSQVLYFLISQT    141 - 210
PLLKESGFRVDRLSGEIRLSGCLDYETAPQFTLLIRARDCGEPSLSSTTTVHVDVQEGNNHRPAFTQENY    211 - 280
KVQIPEGRASQGVLRLLVQDRDSPFTSAWRAKFNILHGNEEGHFDISTDPETNEGILNVIKPLDYETRPA    281 - 350
QSLIIVVENEERLVFCERGKLQPPRKAAASATVSVQVTDANDPPAFHPQSFIVNKEEGARPGTLLGTFNA    351 - 420
MDPDSQIRYELVHDPANWVSVDKNSGVVITVEPIDRESPHVNNSFYVIIIHAVDDGFPPQTATGTLMLFL    421 - 490
SDINDNVPTLRPRSRYMEVCESAVHEPLHIEAEDPDLEPFSDPFTFELDNTWGNAEDTWKLGRNWGQSVE    491 - 560
LLTLRSLPRGNYLVPLFIGDKQGLSQKQTVHVRICPCASGLTCVELADAEVGLHVGALFPVCAAFVALAV    561 - 630
ALLFLLRCYFVLEPKRHGCSVSNDEGHQTLVMYNAESKGTSAQTWSDVEGQRPALLICTAAAGPTQGVKA    631 - 700
YPDATMHRQLLAPVEGRMAETLNQSKERNRFSLSRGCIIPQGRATAGRGLPQDIYKEMMPRRLTQTGKRK    701 - 770
HGALARTPSFKKVVYDHKEDEENKAGRKQRSHLFKVMQLRNEQGGVRVQSAHSPSPLNKKACFPGDYRGE    771 - 840
SAGGHNCRAVSG                                                              841 - 852
//

Text Mined References (8)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19824886 2009 Association and interaction analyses of eight genes under asthma linkage peaks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.