Property Summary

NCBI Gene PubMed Count 238
PubMed Score 1255.97
PubTator Score 909.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.300 2.0e-06
osteosarcoma 1.811 8.1e-03
sonic hedgehog group medulloblastoma 1.300 1.1e-03
atypical teratoid / rhabdoid tumor 1.600 3.5e-03
adrenocortical carcinoma -2.644 5.3e-03
lung cancer 6.100 5.3e-07
interstitial cystitis 1.200 3.8e-05
pediatric high grade glioma 1.200 4.4e-04
posterior fossa group B ependymoma 1.400 1.5e-08
lung carcinoma 4.600 1.7e-48
gastric carcinoma -1.800 5.9e-03
acute myeloid leukemia -1.800 2.7e-02
ovarian cancer 1.200 1.6e-02
pituitary cancer 1.300 6.1e-05
psoriasis -1.400 8.8e-32

Gene RIF (187)

PMID Text
26927375 Data show that grape seed proanthocyanidins could inhibit cell proliferation, invasion and migration of A549 cells, which might be related to the down-regulation of epidermal growth factor receptor and N-cadherin and the up-regulation of E-cadherin.
26702618 These data suggest that the number of polyploid giant cancer cells and the EMT-related proteins E-cadherin, N-cadherin, and vimentin may be valuable biomarkers to assess metastasis in patients with breast cancer.
26451610 Targeting N-cadherin may be a promising therapeutic approach, particularly in cisplatin-resistant, therapy refractory and metastatic Germ cell tumor.
26359363 Metformin's anti-cancer therapeutic effect is mediated through different molecular mechanism in wild-type vs. deficient N-cadherin cancer cells.
26260219 Expression data of NCAD shows no association with advanced gastric cancer brain metastasis.
26093892 Of the seven polymorphisms, two reached statistical significance for obsessive-compulsive disorder under additive and codominant models of inheritance
26069251 Foxn3 is a direct transcriptional suppressor of N-cadherin in colorectal metastasis tissues.
26032459 CDH2 was found to be a susceptibility gene for Gilles de la Tourette syndrome in a Danish cohort.
25936636 N-cadherin was widely expressed in CRC cell lines and silencing of N-cadherin suppressed the proliferation and migration of the CRC cell line HT-29 by upregulating E-cadherin, suggesting a potential role of N-cadherin in inducing EMT.
25803827 It was shown that both E- and N-cadherin mRNA and protein are expressed in the human renal proximal tubule.
25771201 Existing knowledge regarding the role of CDH2 and CDH11 during development and differentiation in vivo and in vitro is reviewed. [review]
25713069 association of beta-catenin with N-cadherin is regulated by actin polymerization during contractile activation
25607384 The aim of this study was to investigate immunohistochemically the E-cadherin/N-cadherin "switch" and vimentin expression as markers of epithelial-mesenchymal transition process in tongue oral squamous cell carcinomas.
25575439 the expression of N-cadherin was associated with Vasculogenic mimicry formation in esophageal squamous cell carcinoma
25542234 the decrease in E-cadherin and/or increase in N-cadherin may be required for BMP4-induced migration and EMT.
25386667 N-cadherin and connexin 43 expression in in group of diffuse astrocytomas and anaplastic astrocytomas may be evidence for their role in tumor formation and progression
25175499 Results suggest that N-cadherin may promote motility and invasiveness through distinct mechanisms and that beta-catenin may be an integral mediator of N-cadherin-dependent invasive signaling in oral epithelia.
25105734 Activin A, B, and AB produce comparable increases in human trophoblast cell invasion by up-regulating N-cadherin expression in a SMAD2/3-SMAD4-dependent manner.
25096247 Results demonstrate that miR-194 affected the growth and metastasis of osteosarcoma cells both in vitro and in vivo suggesting that miR-194 functions as tumor suppressor gene probably by downregulating CDH2 and IGF1R.
25041364 miR-199a targeted the sequence within the 3'UTR of the N-cadherin mRNA and suppressed the TGF-beta1-induced increase in the protein level of N-cadherin in a manner independent of SNAI1.
24985126 Decreased N-cadherin expression is linked to increased ADAM-10 expression in atherosclerotic lesions.
24969562 BMP-7 inhibits TGF-beta-induced cholangiocarcinoma cell migration through inhibition of TGF-beta-mediated Twist and N-cadherin expression
24962344 N-cadherin and CD133 expressions are strongly correlated and N-cadherin appears as a potential breast cancer metastases marker in a specific patient subpopulation.
24914828 This indicates that similar biofunctionalization approaches based on N-cadherin and L1 can be translated to 3-D "transplantable" scaffolds with enhanced neurotrophic behaviors.
24705471 ADAM9 up-regulates N-cadherin via miR-218 suppression in lung adenocarcinoma cells.
24636838 Positive N-cadherin and P-cadherin expression closely correlated with clinicopathological and biological behaviors, and poor-prognosis of gallbladder cancer.
24435707 TWIST1 mediated EGF-induced N-cadherin expression, leading to prostate cancer invasion.
24418088 Studied the expression of E-cadherin, N-cadherin, TGF-beta1 and Twist protein and investigate its significance in the occurrence and development of prostate cancer.
24378362 The overexpression of N-cadherin, a structural molecule in adherence junctions in MSCs, promoted VCAM-1 expression and induced the marked phosphorylation of the intracellular signaling factor, Src.
24345743 In response to Candida albicans infection, SEPT7 forms a complex with endothelial cell N-cadherin, is required for normal accumulation of N-cadherin around hyphae, and is necessary for maximal fungal endocytosis.
24294380 N-cadherin had no diagnostic value in arrhythmogenic right ventricular cardiomyopathy.
24227724 The tangential migration to the cortex of N-cadherin ablated cells is delayed and their radial migration is perturbed.
24165969 N-cadherin is constitutively expressed by monocyte-derived DCs.
24148886 CDH2 promoter polymorphism influences the risk of OA, and hnRNP K was found to be involved in the regulation of elevated N-cadherin expression in patients with OA carrying the minor allele of rs11564299.
24051540 Interleukin-6-induced Twist and N-cadherin have roles in melanoma cell metastasis
24046456 The knockdown of flotillins dramatically affected N- and E-cadherin recruitment at CCJs in mesenchymal and epithelial cell types and perturbed CCJ integrity and functionality
23991044 Data indicate that E-cadherin was elevated , and the expression levels of N-cadherin, Vimentin and Twist1 were all decreased in oleanolic acid (OA)-treated cells.
23900215 CDH-2 expression correlated positively with the invasiveness of colon cancer cells
23899519 These results suggest that N-cadherin is a novel prospective cell surface marker of human mesenchymal stem cells that show a better ability for cardiomyocyte differentiation.
23799912 High N-cadherin expression is associated with malignant bone and soft tissue tumors.
23733927 N-cadherin is a key factor in mediating cell-cell interactions during mesenchymal condensation and chondrogenesis.
23626818 Cell surface localization of alpha3beta4 nicotinic acetylcholine receptors is regulated by N-cadherin homotypic binding and actomyosin contractility.
23626784 The overexpression of Twist and N-cadherin could be considered as useful biomarkers for predicting the prognosis of NSCLC.
23520479 In biopsies of resistant cancers, N-cadherin expression was increased in 10 out of 13 cases. Induction of the EMT was consistent with aggressive characteristics. Inhibition of N-cadherin expression by siRNA was tested to reduce proliferation and invasion.
23438504 circulating N-cadherin levels are a viable prognostic marker for high-risk MM patients.
23420609 Removal of N-cadherin in the neurogenic niche of dopaminergic (DA) neurons in the ventral midbrain (vMB) disrupts the adherens junctions and the process of DA neurogenesis via activation of canonical Wnt-beta-catenin signaling in the vMB.
23398382 The expression of n-cadherin is increased while the p-caherin expression is decreased in patients with Leydig cell tumors.
23321619 Data indicate that both N706S and N845S variants conferred reduced CDH2 protein expression in transfected cells.
23314859 Expression of N-cadherin did not differ significantly according to clinical and pathological characteristics in colon cancer patients.
23290789 Results suggest that Tgase-2/PP2A/JNK might be a novel axis that affects N-cadherin switching in the epithelial-mesenchymal-transition (EMT) of A549 lung cancer cells.
23276695 AQP1(+) cells immediately beneath the epithelial basement membrane may be stromal niche-like cells that directly interact with N-cad(+) limbal basal epithelial progenitor cells.
23240619 Expression of N-cadherin is associated with the malignant progression of brainstem gliomas.
23216791 N-cadherin is required to maintain the expression of VE-cadherin in malignant tumor cells but not vice versa. Thus, N-cadherin acts in concert with VE-cadherin to promote tumor growth.
23086683 Overexpression of NEDD9 correlated with abnormal expression of E-cadherin, beta-catenin and N-cadherin.
22976797 Neuronal cadherin and alpha9-integrin are postulated as leading actors in the association between the Notch pathway and promotion of cell adhesion, motility and invasion in rhabdomyosarcoma cells
22912891 Data indicate that cultured tubular cells (hPTECs) reorganized into patches of cells with homotypic N-cadherin or E-cadherin cell-cell adhesions.
22888908 N-cadherin represents the first immunhistochemical marker for a clear cut differentiation between papillary renal cell carcinoma type I and type II.
22846995 Galectin-3 protein regulates mobility of N-cadherin and GM1 ganglioside at cell-cell junctions of mammary carcinoma cells.
22810307 We have, to our knowledge, demonstrated a previously unreported role for GSK3beta in modulating the motile and invasive behavior of melanoma cells through N-cadherin and FAK.
22767590 high intracellular PKCK2 activity confers anoikis resistance on esophageal cancer cells by inducing E- to N-cadherin switching.
22637581 an inhibition of N-cadherin function by proteolytically generated N-cadherin C-terminal fragment 1 might play an important role in Alzheimer's disease progression by accelerating amyloid-b-triggered synapse damage.
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of cadherin 2, type 1, N-cadherin (neuronal) (CDH2) in U-937 macrophages
22615994 Cx43 and N-cadherin are potential therapeutic targets in the promotion of healing of venous leg ulcers, by acting at least in part through distinct contributions of cell adhesion, migration, proliferation and cytoskeletal dynamics.
22576709 Although E-cadherin was expressed significantly less in cases of GISTs with distant metastasis (p < 0.05), expression of N-cadherin did not differ significantly according to clinical and pathological characteristics.
22490896 Although the expressions of E-cadherin and N-cadherin appear to be correlated with survival outcomes in bladder cancer, N-E cadherin switch may be a better predicator for postoperative recurrence and cancer-related survival.
22490800 The expression of N-cadherin was not significantly different between metastatic gastrointestinal stromal tumors and normal tissue.
22421353 Data indicate that up-regulation of Slug was significantly correlated with a higher tumor stage and the E- to N-cadherin switch in bladder cancer cells and tissues.
22405962 Severely hypoplastic left hearts and borderline left ventricle hearts showed reduced N-cadherin expression in interacalated disks.
22385354 Nuclear N-cadherin expression may represent a valuable prognostic marker in nasopharyngeal carcinoma patients, especially those with late stage disease.
22360503 N-cadherin expression may be a useful prognostic marker in gastric cancer.
22344255 N-glycosylation alters cadherin binding kinetics.
22275437 re-expression of N-cadherin in gliomas restores cell polarity and strongly reduces cell velocity, suggesting that loss of N-cadherin could contribute to the invasive capacity of tumour astrocytes
22166980 Twist is an upstream regulator of N-cadherin-mediated invasion of human trophoblastic cells.
22072429 N-cadherin was not associated with histopathologic type, metastasis or mortality in oropharyngeal squamous cell carcinoma.
22040951 N-cadherin-mediated adhesion keeps N-cadherin positive leukemia cells in the quiescent state of the G(0) phase, thus protecting leukemia cells against VP16 chemotherapy.
21990317 E- and N-cadherins are expressed at the surface of human beta-cells and that these adhesion molecules are involved in the maintenance of beta-cell viability
21858092 Data show that EMD significantly increased the expression of connexin 43 and N-cadherin at early time points ranging from 2 to 5 days.
21855541 The N-cadherin in prostate cancer cell mediates cell-cell adhesion and regulates MCP-1 expression via the PI3K/Akt signaling pathway.
21852538 expression of calsenilin leads to a disruption of presenilin 1/gamma-secretase-mediated epsilon-cleavage of N-cadherin, which results in the significant accumulation of N-cadherin C-terminal fragment 1
21845495 miR-194 interacted with N-cadherin and negatively regulated its expression at the translational level.
21828122 myeloma cells frequently display aberrant expression of N-cadherin and that N-cadherin mediates the interaction of myeloma cells with the bone marrow microenvironment, in particular the osteoblasts.
21785870 expression of ZO-1 and N-cadherin may reflect the mechanisms leading to rosette formation in neuroendocrine tumors
21777276 N-cad expression is decreased in hepatocellular carcinoma, and the downregulation of N-cad is associated with the metastatic potential and poorer surgical prognosis.
21596022 KLK13 was found to induce the expression of N-cadherin to help promote lung tumor cell motility.
21423153 Our results indicate that a subgroup of intrahepatic cholangiocarcinoma characterized by cholangiolar differentiation and N-cadherin expression is strongly associated with viral hepatitis.
21315259 Cadherin 2 is required for regulation of somal translocation of neurons in the neocortex.
21315068 Data suggest that excess hyaluronan synthesis suppresses cell proliferation through diminished N-cadherin expression and promotion of homotypic E-cadherin mediated cell-cell adhesion.
21177868 The dissociation of N-cadherin-mediated synaptic contact by Abeta may underlie the pathological basis of neurodegeneration such as neuronal death, synaptic loss, and Tau phosphorylation in Alzheimer disease brain
21176502 N-cadherin is a receptor for adhesion and endocytosis of Aspergillus fumigatus by HUVEC.
21156175 expression of the wild type - but not the GPS cleavage-deficient CD97 up-regulates the expression of N-cadherin, leading to Ca(++)-dependent cell-cell aggregation.
21123580 Levels of N-cadherin are decreased at synaptic sites following impairment of ADAM10 activity.
21122409 The positive expression rate of N-cadherin is decreased in osteosarcoma, and is is closely correlated with metastasis and prognosis.
21084302 N-cadherin cell-cell adhesion complexes are regulated by fibronectin matrix assembly.
21080917 Data show that protein and mRNAs of E- and N-cadherin and beta-catenin were higher in early gestation compared to of the end, and that expression of these factors was higher during lung development than in the adult human lung.
21070371 High expression of N-cadherin was observed in 10 of 15 spindle cell carcinoma (SpCC) cases. Six of 7 SpCC cases with metastasis showed high expression of N-cadherin.
21057494 N-cadherin is a major cause of both prostate cancer metastasis and castration resistance. Therapeutic targeting of this factor with monoclonal antibodies may have considerable clinical benefit.
21042713 Oncologic trogocytosis with Hospicells induces the expression of N-cadherin by breast cancer cells.
20811707 Suggest that TC21 promotes cell motility and metastasis by regulating the expression of E-cadherin and N-cadherin in hepatocellular carcinoma and is associated with tumor progression and poor prognosis in HCC.
20738806 Smad7 suppresses beta-catenin degradation and promotes interaction with N-cadherin, stabilizing association with neighboring dermal fibroblasts, thus mitigating invasion.
20735983 These results suggested that the cleavage of N-cadherin is essential for chondrocyte differentiation.
20664068 Neural cadherin mediates cell to cell adhesion and signal transduction with early osteoblastic differentiation.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20630685 Suggest that disruption of N-cadherin-mediated cell-cell contacts is a potential strategy for reducing vascular smooth muscle cell migration and intimal thickening.
20605145 Expression of N-cadherin in endometrium and fallopian tubes from infertile women was discontinued in atrophic patches.
20451421 Gain of N-cadherin expression is associated with non-muscle-invasive bladder cancer.
20388391 The positive expression of N-cadherin was correlated to cell the tissue differentiation in invasive ductal carcinoma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20308060 The PX-RICS-14-3-3zeta/theta complex couples N-cadherin-beta-catenin with dynein-dynactin to mediate its export from the endoplasmic reticulum.
20233707 Androgen deprivation induces N-cadherin in prostate tumors. Moreover, N-cadherin was increased in castration-resistant tumors in patients with established metastases.
20204300 decrease of E-cadherin and the gain of N-cadherin gene expression are risk factors for cancer-related death in bladder cancer
20139113 MMP-7 is involved in the cleavage of N-cadherin and modulates vascular smooth muscle cell apoptosis, and may contribute to atherosclerotic plaque development and rupture.
20137108 N-cadherin plays an important role in maintaining the self-renewal and drug resistance properties of leukemic stem cells.
20117462 In atrial fibrillation, angiotensin II activates CTGF via activation of Rac1 and nicotinamide adenine dinucleotide phosphate oxidase, leading to up-regulation of Cx43, N-cadherin, and interstitial fibrosis.
20116358 The results indicate that N-cadherin is involved in the bidirectional interaction of human ematopoietic stem cells with their cellular determinants in the niche.
20082286 These results demonstrate a chondrogenic-SMC fate decision mediated by cell shape, Rac1, and N-cadherin, and highlight the tight coupling between lineage commitment and the many changes in cell shape and cell adhesion that occur during morphogenesis.
19919954 the extracellular domains of E- and N-cadherin determines the basic localization pattern, whereas the cytoplasmic domains modulate it thereby affects the cell adhesion activity, subapical accumulation, and the formation of adherens junction.
19898423 alterations of N-cadherin expression in gastrointestinal endometriosis may have an important role in the mechanism that underlies deep tissue invasion, and possibly also in the development of malignancy
19584275 Data show that increased association of junctional plakoglobin with N-cadherin was a distinguishing feature of LMP1-expressing cells.
19580633 Active matrix metalloproteinase-2 promotes apoptosis of hepatic stellate cells via the cleavage of cellular N-cadherin.
19530221 IGF-1 released from corneal epithelial cells up-regulates the expression of N-cadherin in corneal fibroblasts.
19501458 lebectin acts on N-cadherin-mediated cell-cell contacts through PI3K/Akt pathway.
19448425 Down-regulation of E-cadherin and up-regulation of N-cadherin may be involved in the genesis of esophageal squamous cell carcinoma. Silencing N-cadherin using RNA interference could inhibit the invasiveness of EC9706 cells in vitro.
19339270 Observational study of gene-disease association. (HuGE Navigator)
19324354 N- and E-cadherin expression in the human fetal ovary indicates likely roles in gonadal development from germ cell proliferation to primordial follicle formation, as well as in the development of the urogenital ducts of both genders.
19222093 N-cadherin expression is correlated with the invasion and aggravation of esophageal squamous cell carcinoma.
19190132 High N-cadherin expression is associated with metastatic spread to the brain in primary non-small cell lung cancer.
19124205 The mean values of the percentage of positive cells for n-cadherin between extra-abdominal desmoid tumor did not demonstrate any statistically significant difference
19101069 Wnt16 does not activate canonical Wnt signaling in E2A-PBX1-positive cells. Instead, beta-catenin is involved in N-cadherin-dependent adherence junctions
19070520 N/E- cadherin expression profile has a significant prognostic value in invasive bladder cancer.
19043453 Protein phosphatase Dusp26 associates with KIF3 motor and promotes N-cadherin-mediated cell-cell adhesion.
19033391 HER2 affects glial-cell migration by modulating EGFR-HER2 signal transduction, and that this effect is mediated by N-cadherin.
18979298 N-cadherin mRNA and protein expression decreased over time as human dermal microvascular endothelial cells grew into a confluent monolayer.
18978678 Observational study of gene-disease association. (HuGE Navigator)
18801083 Discontinuous staining of N-cadherin and loss of E-cadherin expression in hepatocellular carcinoma predicts a high risk of recurrence after surgical treatment.
18622386 N-cadherin serves as diagnostic biomarker in intrahepatic and perihilar cholangiocarcinomas.
18495274 Increasing N-cadherin expression may be one of the potential mechanisms of hepatocyte growth factor-mediating improvement of cardiac function in mice with dilated cardiomyopathy.
18414176 In ductal carcinomas, decreased levels of N-cadherin in primary tumors correlate with local recurrence and death in long-term followup of patients.
18362184 Initiation of the signal requires two collagen receptors, alpha2beta1 integrin and discoidin domain receptor (DDR). Each receptor propagates signals through separate pathways that converge to up-regulate N-cadherin.
18269586 The level of expression of N-cadherin between types of lung tumours does not appear to indicate malignant potential or aggressive behaviour.
17944884 The overexpression of N-cadherin is significantly related to postoperative recurrence within 2 years after surgical resection in hepatocellular carcinoma
17868645 In conclusion, N-cadherin modifies Kv1.5 channel activity and is thus a novel candidate signaling molecule participating in the regulation of a variety of functions including cardiac action potential and vascular tone.
17668445 Two independent pools of N-cadherin exist on melanoma cell surface: one pool is independent of lipid rafts and is engaged in cell-cell junctions, while a second pool is localized in membrane rafts and does not participate in cell-cell adhesions.
17646933 Ep-CAM cross signaling with N-cadherin involves Pi3K, resulting in the abrogation of the cadherin adhesion complexes in epithelial cells.
17512904 Twist regulates cell motility and invasion in gastric cancer cell lines, probably through the N-cadherin and fibronectin production
17389597 abnormal activation of glycogen synthase kinase 3beta can reduce neuronal viability and synaptic plasticity via modulating Presenilin 1/N-cadherin/beta-catenin interaction and thus have important implications in the pathophysiology of Alzheimer disease.
17348027 EGCG downregulated N-cadherin in a dose-dependent manner where reduction in N-cadherin expression paralleled declining migratory potential.
17255093 in motile cells beta-catenin is recruited by IQGAP1 and N-cadherin to active membrane ruffles, wherein beta-catenin mediates the internalization and possible recycling of the membrane-associated proteins N-cadherin and APC
17229887 N-cadherin and beta-catenin play role in cell migration via PDGF-Rbeta-mediated signaling through the scaffolding molecule NHERF2
17178870 JNK1 is activated in response to collagen I, which increases tumorigenesis by up-regulating N-cadherin expression and by increasing motility.
17171299 engagement of N-cadherin provides a stop signal for breast carcinoma cell migration
17031402 Reduced E-cadherin expression was found in pseudomyxoma peritonei.
17008425 These results indicate that N-cadherin may be a critical cell-to-cell adhesion molecule between corneal epithelial stem/progenitor cells and their corresponding niche cells in the limbal epithelium.
16969099 N-cadherin and beta3 integrin expression correlates with progression to advanced-stage melanoma.
16819153 N-cadherin was selectively expressed on epithelial cells of the thymus, pituitary, pancreas, liver, adrenal, endometrium of the uterus, ovary, and stomach as well as in neuronal tissues.
16707106 beta-catenin is regulated via epsilon-cleavage of N-cadherin
16675571 N-cadherin acts in an invasive mode in bladder cancer, but whether it has a primary role in urothelial neoplastic progression has yet to be investigated.
16596172 N-cadherin up-regulation is associated with recurrent hepatocellular carcinomas
16371504 The data suggest a novel role for tyrosine phosphorylation of N-cadherin by Src family kinases in the regulation of beta-catenin association during transendothelial migration of melanoma cells.
16258702 N-cadherin is associated with tumor aggressiveness and metastatic potential and may contribute to tumor progression
16173043 demonstrated for the first time that N-cadherin switching occurs in higher grade prostate cancer and correlates significantly with increasing Gleason patterns; N-cadherin may be a useful biomarker of aggressive PC
16149052 ERK activation and p21 and N-cadherin upregulation are required for genistein-induced neuronal differentiation
16091424 Data suggest that a vimentin-based N-cadherin complex functions together with an actin-based complex to promote strong cell-cell adhesion in fibroblasts.
15987741 N-cadherin plays a key role in the transendothelial migration of melanoma cells
15855653 Co-localization of ZO-1 with N-cadherin. Zonula occludens protein-1 has role in N-cadherin-based adhesion.
15774907 vascular smooth muscle cell survival is dependent on N-cadherin-mediated cell-cell contacts, which could be important in the context of plaque instability
15731052 cleaved by Porphyromonas gingivalis gingipains in endothelial cells
15713751 cadherin switching (downregulation of E-cadherin and upregulation of N-cadherin) is necessary for increased motility but is not required for the morphological changes that accompany the epithelium-to-mesenchyme transition
15701645 regulation of N-cadherin is a crucial event and it has a role in controlling the survival capability of human ovarian surface epithelial cells
15648948 The topics discussed in this review point to N-cadherin as an important player in tumor development and, therefore, a potential target for novel therapeutic approaches.
15541732 Sp1/Sp3 and MZF1 are important transcription factors regulating N-cadherin promoter activity and expression in osteoblasts.
15527101 Decreased expression of N-cadherin correlated with a dramatic increase in invasive behavior of glioma cells
15355896 High expression of N-cadherin is associated with esophageal carcinoma invasiveness
15331629 Data show that N-cadherin, expressed at the tips of filopodia in colon cancer-derived myofibroblasts invading extracellular matrices in vitro, is upregulated by TGF-beta.
15263022 a subset of integrin signaling molecules, namely Fak and paxillin, but not p130 Crk-associated substrate or proline-rich tyrosine kinase 2, participate in processes regulating N-cadherin-based cell-cell adhesion
15252840 N-cadherin involved in primary colon cancer progression, promoting tumor invasiveness
15217949 N-cadherin may have a role in the epithelial-mesenchymal transition in pancreatic carcinoma
15153430 E- to N-cadherin switching in epithelial carcinomas has a potential impact on metastatic progression.
14675278 In human melanocytic tumors, a causative role of (loss of ) E-cadherin or (gain of ) N-cadherin for melanocytic tumor progression still remains to be proven.
14559901 the comparable region of N-cadherin can substitute for this required region in E-cadherin and is required for suppression by the mutant form of N-cadherin that is capable of suppressing
14515347 Presenilin-1-mediated delivery of N-cadherin to the plasma membrane is important for N-cadherin to exert its physiological function, and it may control the state of cell-cell contact.
13678586 N-cadherin cleavage by presenilin 1 is regulated by NMDA receptor
12545205 carbohydrate profile of this protein synthesized in human melanoma cell lines. N-glycans of N-cadherin are altered in metastatic melanomas in a way characteristic for invasive tumor cells.
12398894 Protection of the FGFR-1 from fgf-2-induced downregulation by N-cadherin enhances receptor signaling and provides a mechanism by which tumor cells can acquire metastatic properties
12095980 N-cadherin signal transduction upregulates Bcl-2
12057916 expression patterns of E- and N-cadherins in both embryonic and adult (healthy, injured, carious) human teeth
11996105 Expression of beta1-integrins and N-cadherin in bladder cancer and melanoma cell lines
11790800 Cadherin-mediated cell sorting not determined by binding or adhesion specificity

AA Sequence

MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKFSNCNGKRKVQ      1 - 70
YESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEE     71 - 140
IVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIF    141 - 210
IINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGS    211 - 280
KPGTYVMTVTAIDADDPNALNGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQ    281 - 350
ATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVY    351 - 420
RISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVID    421 - 490
VNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLD    491 - 560
RESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPDPNSINITALDYDI    561 - 630
DPNAGPFAFDLPLSPVTIKRNWTITRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKV    631 - 700
CQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNI    701 - 770
LKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGL    771 - 840
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD        841 - 906
//

Text Mined References (243)

PMID Year Title
26927375 2016 [Grape seed proanthocyanidins inhibits the invasion and migration of A549 lung cancer cells].
26702618 2015 The number of polyploid giant cancer cells and epithelial-mesenchymal transition-related proteins are associated with invasion and metastasis in human breast cancer.
26451610 2015 Role of N-cadherin in proliferation, migration, and invasion of germ cell tumours.
26359363 2015 Metformin represses cancer cells via alternate pathways in N-cadherin expressing vs. N-cadherin deficient cells.
26260219 2015 Clinicopathological significance of N-cadherin and VEGF in advanced gastric cancer brain metastasis and the effects of metformin in preclinical models.
26093892 2016 Polymorphisms within the neuronal cadherin (CDH2) gene are associated with obsessive-compulsive disorder (OCD) in a South African cohort.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26069251 2015 A Systematic Approach to Defining the microRNA Landscape in Metastasis.
26032459 2015 Association study between CDH2 and Gilles de la Tourette syndrome in a Danish cohort.
25936636 2015 N-cadherin, a novel prognostic biomarker, drives malignant progression of colorectal cancer.
25803827 2015 Cadherin expression, vectorial active transport, and metallothionein isoform 3 mediated EMT/MET responses in cultured primary and immortalized human proximal tubule cells.
25771201 2015 CDH2 and CDH11 act as regulators of stem cell fate decisions.
25713069 2015 Recruitment of ?-catenin to N-cadherin is necessary for smooth muscle contraction.
25607384 2014 The immunohistochemical investigations of cadherin "switch" during epithelial-mesenchymal transition of tongue squamous cell carcinoma.
25575439 2015 N-cadherin participated in invasion and metastasis of human esophageal squamous cell carcinoma via taking part in the formation of vasculogenic mimicry.
25542234 2015 N-cadherin mediates the migration of MCF-10A cells undergoing bone morphogenetic protein 4-mediated epithelial mesenchymal transition.
25386667 2015 N-cadherin, beta-catenin and connexin 43 expression in astrocytic tumours of various grades.
25175499 2014 The cytoplasmic domain of N-cadherin modulates MMP?9 induction in oral squamous carcinoma cells.
25105734 2014 Activin A, B, and AB increase human trophoblast cell invasion by up-regulating N-cadherin.
25096247 2014 microRNA-194 suppresses osteosarcoma cell proliferation and metastasis in vitro and in vivo by targeting CDH2 and IGF1R.
25041364 2014 Suppression of the TGF-?1-induced protein expression of SNAI1 and N-cadherin by miR-199a.
24985126 2014 ADAM-10 could mediate cleavage of N-cadherin promoting apoptosis in human atherosclerotic lesions leading to vulnerable plaque: a morphological and immunohistochemical study.
24969562 2014 BMP-7 blocks the effects of TGF-?-induced EMT in cholangiocarcinoma.
24962344 2014 Strong correlation between N-cadherin and CD133 in breast cancer: role of both markers in metastatic events.
24914828 2014 Engineered N-cadherin and L1 biomimetic substrates concertedly promote neuronal differentiation, neurite extension and neuroprotection of human neural stem cells.
24705471 2014 ADAM9 up-regulates N-cadherin via miR-218 suppression in lung adenocarcinoma cells.
24636838 2014 N-cadherin and P-cadherin are biomarkers for invasion, metastasis, and poor prognosis of gallbladder carcinomas.
24435707 2014 A ROS/STAT3/HIF-1? signaling cascade mediates EGF-induced TWIST1 expression and prostate cancer cell invasion.
24418088 2014 Expression and significance of E-cadherin, N-cadherin, transforming growth factor-?1 and Twist in prostate cancer.
24378362 2014 Cell-cell adhesion through N-cadherin enhances VCAM-1 expression via PDGFR? in a ligand-independent manner in mesenchymal stem cells.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24345743 2013 Role of endothelial cell septin 7 in the endocytosis of Candida albicans.
24294380 2013 Clinical usefulness of immunohistochemistry for plakoglobin, N-cadherin, and connexin-43 in the diagnosis of arrhythmogenic right ventricular cardiomyopathy.
24227724 2013 N-cadherin sustains motility and polarity of future cortical interneurons during tangential migration.
24165969 2014 Langerhans cell maturation is accompanied by induction of N-cadherin and the transcriptional regulators of epithelial-mesenchymal transition ZEB1/2.
24148886 2014 N-cadherin promoter polymorphisms and risk of osteoarthritis.
24051540 2013 Interleukin-6-induced Twist and N-cadherin enhance melanoma cell metastasis.
24046456 2013 Flotillin microdomains stabilize cadherins at cell-cell junctions.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23991044 2013 Oleanolic acid suppresses migration and invasion of malignant glioma cells by inactivating MAPK/ERK signaling pathway.
23900215 2013 LSD1-mediated epigenetic modification contributes to proliferation and metastasis of colon cancer.
23899519 2013 N-Cadherin is a prospective cell surface marker of human mesenchymal stem cells that have high ability for cardiomyocyte differentiation.
23799912 2013 Soluble Neural-cadherin as a novel biomarker for malignant bone and soft tissue tumors.
23733927 2013 Hydrogels that mimic developmentally relevant matrix and N-cadherin interactions enhance MSC chondrogenesis.
23626818 2013 Cell surface localization of ?3?4 nicotinic acetylcholine receptors is regulated by N-cadherin homotypic binding and actomyosin contractility.
23626784 2013 Prognostic significance of twist and N-cadherin expression in NSCLC.
23520479 2013 N-cadherin expression is associated with acquisition of EMT phenotype and with enhanced invasion in erlotinib-resistant lung cancer cell lines.
23438504 2013 Circulating N-cadherin levels are a negative prognostic indicator in patients with multiple myeloma.
23420609 2013 N-cadherin regulates the proliferation and differentiation of ventral midbrain dopaminergic progenitors.
23398382 2013 Switch of cadherin expression as a diagnostic tool for Leydig cell tumours.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23321619 2013 Rare missense neuronal cadherin gene (CDH2) variants in specific obsessive-compulsive disorder and Tourette disorder phenotypes.
23314859 2013 Positive expression of LSD1 and negative expression of E-cadherin correlate with metastasis and poor prognosis of colon cancer.
23290789 2013 Transglutaminase-2 induces N-cadherin expression in TGF-?1-induced epithelial mesenchymal transition via c-Jun-N-terminal kinase activation by protein phosphatase 2A down-regulation.
23276695 2013 Aquaporin 1-positive stromal niche-like cells directly interact with N-cadherin-positive clusters in the basal limbal epithelium.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23240619 2013 Expression of ?-catenin and E- and N-cadherin in human brainstem gliomas and clinicopathological correlations.
23216791 2012 Interplay between neural-cadherin and vascular endothelial-cadherin in breast cancer progression.
23086683 2013 Overexpression of NEDD9 is associated with altered expression of E-Cadherin, ?-Catenin and N-Cadherin and predictive of poor prognosis in non-small cell lung cancer.
22976797 2012 Notch-mediated induction of N-cadherin and ?9-integrin confers higher invasive phenotype on rhabdomyosarcoma cells.
22912891 2012 Distinct mesenchymal alterations in N-cadherin and E-cadherin positive primary renal epithelial cells.
22888908 2012 N-cadherin is differentially expressed in histological subtypes of papillary renal cell carcinoma.
22846995 2012 Galectin-3 protein regulates mobility of N-cadherin and GM1 ganglioside at cell-cell junctions of mammary carcinoma cells.
22810307 2012 GSK3? inhibition blocks melanoma cell/host interactions by downregulating N-cadherin expression and decreasing FAK phosphorylation.
22767590 2012 Protein kinase casein kinase 2-mediated upregulation of N-cadherin confers anoikis resistance on esophageal carcinoma cells.
22637581 2012 C-terminal fragment of N-cadherin accelerates synapse destabilization by amyloid-?.
22615994 2012 Targeting Cx43 and N-cadherin, which are abnormally upregulated in venous leg ulcers, influences migration, adhesion and activation of Rho GTPases.
22576709 2012 Expression and significance of twist, E-cadherin, and N-cadherin in gastrointestinal stromal tumors.
22490896 2012 [Analysis of N-E cadherin switch as an independent predictive parameter of bladder cancer survival outcomes].
22490800 2012 [Expression and significance of Slug, E-cadherin and N-cadherin in gastrointestinal stromal tumors].
22467863 2012 Radixin regulates cell migration and cell-cell adhesion through Rac1.
22421353 2013 Slug contributes to cadherin switch and malignant progression in muscle-invasive bladder cancer development.
22405962 2012 Disturbed myocardial connexin 43 and N-cadherin expressions in hypoplastic left heart syndrome and borderline left ventricle.
22385354 2012 Nuclear expression of N-cadherin correlates with poor prognosis of nasopharyngeal carcinoma.
22365631 2012 Genome-wide association study of temperament in bipolar disorder reveals significant associations with three novel Loci.
22360503 2012 Clinical implications of N-cadherin expression in gastric cancer.
22344255 2012 N-glycosylation alters cadherin-mediated intercellular binding kinetics.
22275437 2012 N-cadherin expression level modulates integrin-mediated polarity and strongly impacts on the speed and directionality of glial cell migration.
22166980 2012 Twist modulates human trophoblastic cell invasion via regulation of N-cadherin.
22072429 2012 Lack of association of cadherin expression and histopathologic type, metastasis, or patient outcome in oropharyngeal squamous cell carcinoma: a tissue microarray study.
22040951 2011 [Resistance of leukemia KG1a cells with positive N-cadherin in phase G(0) against killing activity of VP16].
21990317 2011 Cadherin engagement protects human ?-cells from apoptosis.
21858092 2011 Premature osteoblast clustering by enamel matrix proteins induces osteoblast differentiation through up-regulation of connexin 43 and N-cadherin.
21855541 2011 N-cadherin mediates angiogenesis by regulating monocyte chemoattractant protein-1 expression via PI3K/Akt signaling in prostate cancer cells.
21852538 2011 Calsenilin regulates presenilin 1/?-secretase-mediated N-cadherin ?-cleavage and ?-catenin signaling.
21845495 2012 Inverse association between miR-194 expression and tumor invasion in gastric cancer.
21828122 2011 N-cadherin-mediated interaction with multiple myeloma cells inhibits osteoblast differentiation.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
21785870 2011 Specific expression of ZO-1 and N-cadherin in rosette structures of various tumors: possible recapitulation of neural tube formation in embryogenesis and utility as a potentially novel immunohistochemical marker of rosette formation in pulmonary neuroendocrine tumors.
21777276 2012 Reduced N-cadherin expression is associated with metastatic potential and poor surgical outcomes of hepatocellular carcinoma.
21596022 2011 Epigenetic activation of human kallikrein 13 enhances malignancy of lung adenocarcinoma by promoting N-cadherin expression and laminin degradation.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21423153 2011 Viral hepatitis is associated with intrahepatic cholangiocarcinoma with cholangiolar differentiation and N-cadherin expression.
21357690 2011 RET modulates cell adhesion via its cleavage by caspase in sympathetic neurons.
21315259 2011 Reelin regulates cadherin function via Dab1/Rap1 to control neuronal migration and lamination in the neocortex.
21315068 2011 Hyaluronan suppresses prostate tumor cell proliferation through diminished expression of N-cadherin and aberrant growth factor receptor signaling.
21177868 2011 N-cadherin regulates p38 MAPK signaling via association with JNK-associated leucine zipper protein: implications for neurodegeneration in Alzheimer disease.
21176502 2010 [N-cadherin as a receptor for adhesion and endocytosis of Aspergillus fumigatus by human umbilical vein endothelial cells].
21156175 2011 GPS autoproteolysis is required for CD97 to up-regulate the expression of N-cadherin that promotes homotypic cell-cell aggregation.
21123580 2010 Synaptic localization and activity of ADAM10 regulate excitatory synapses through N-cadherin cleavage.
21122409 2010 [Expression and significance of N-cadherin and ?-catenin protein in osteosarcoma].
21084302 2011 N-cadherin cell-cell adhesion complexes are regulated by fibronectin matrix assembly.
21080917 2010 Epithelial N-cadherin and nuclear ?-catenin are up-regulated during early development of human lung.
21070371 2011 N-cadherin expression is correlated with metastasis of spindle cell carcinoma of head and neck region.
21057494 2010 Monoclonal antibody targeting of N-cadherin inhibits prostate cancer growth, metastasis and castration resistance.
21042713 2010 Oncologic trogocytosis with Hospicells induces the expression of N-cadherin by breast cancer cells.
20811707 2010 TC21 promotes cell motility and metastasis by regulating the expression of E-cadherin and N-cadherin in hepatocellular carcinoma.
20738806 2010 Smad7 restricts melanoma invasion by restoring N-cadherin expression and establishing heterotypic cell-cell interactions in vivo.
20735983 2010 The cleavage of N-cadherin is essential for chondrocyte differentiation.
20664068 2010 Role of neural-cadherin in early osteoblastic differentiation of human bone marrow stromal cells cocultured with human umbilical vein endothelial cells.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20630685 2010 Inhibition of N-cadherin retards smooth muscle cell migration and intimal thickening via induction of apoptosis.
20605145 2010 Expression of E- and N-cadherin and CD44 in endometrium and hydrosalpinges from infertile women.
20451421 Expression profile of E-cadherin and N-cadherin in non-muscle-invasive bladder cancer as a novel predictor of intravesical recurrence following transurethral resection.
20388391 2010 [Expression of Twist, E-cadherin and N-cadherin in breast carcinoma and their clinical significance].
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20308060 2010 The PX-RICS-14-3-3zeta/theta complex couples N-cadherin-beta-catenin with dynein-dynactin to mediate its export from the endoplasmic reticulum.
20233707 2010 N-cadherin increases after androgen deprivation and is associated with metastasis in prostate cancer.
20204300 2010 The prognostic value of cadherin switch in bladder cancer.
20139113 2010 MMP-7 mediates cleavage of N-cadherin and promotes smooth muscle cell apoptosis.
20137108 2010 [Role of N-cadherin in maintaining leukemic stem cell properties].
20117462 2010 Rac1-induced connective tissue growth factor regulates connexin 43 and N-cadherin expression in atrial fibrillation.
20116358 2010 N-cadherin is expressed on human hematopoietic progenitor cells and mediates interaction with human mesenchymal stromal cells.
20082286 2010 Stem cell shape regulates a chondrogenic versus myogenic fate through Rac1 and N-cadherin.
19919954 2010 The extracellular domains of E- and N-cadherin determine the scattered punctate localization in epithelial cells and the cytoplasmic domains modulate the localization.
19898423 2010 Cadherin expression in gastrointestinal tract endometriosis: possible role in deep tissue invasion and development of malignancy.
19584275 2009 Epstein-Barr virus latent membrane protein-1 effects on junctional plakoglobin and induction of a cadherin switch.
19580633 2009 Active matrix metalloproteinase-2 promotes apoptosis of hepatic stellate cells via the cleavage of cellular N-cadherin.
19530221 2009 IGF-1 released by corneal epithelial cells induces up-regulation of N-cadherin in corneal fibroblasts.
19501458 2009 Lebectin increases N-cadherin-mediated adhesion through PI3K/AKT pathway.
19448425 2009 Expression of N-cadherin in esophageal squamous cell carcinoma and silencing expression of N-cadherin using RNA interference on invasiveness of EC9706 cells.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19324354 2010 N- and E-cadherin expression in human ovarian and urogenital duct development.
19222093 2009 N-cadherin knock-down decreases invasiveness of esophageal squamous cell carcinoma in vitro.
19190132 2009 The expression of three genes in primary non-small cell lung cancer is associated with metastatic spread to the brain.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19124205 2009 Analysis of APC, alpha-, beta-catenins, and N-cadherin protein expression in aggressive fibromatosis (desmoid tumor).
19101069 2009 beta-catenin is involved in N-cadherin-dependent adhesion, but not in canonical Wnt signaling in E2A-PBX1-positive B acute lymphoblastic leukemia cells.
19070520 Phospho-Akt pathway activation and inhibition depends on N-cadherin or phospho-EGFR expression in invasive human bladder cancer cell lines.
19043453 2009 Protein phosphatase Dusp26 associates with KIF3 motor and promotes N-cadherin-mediated cell-cell adhesion.
19033391 2008 EGFR-dependent migration of glial cells is mediated by reorganisation of N-cadherin.
18979298 2008 N-cadherin levels in endothelial cells are regulated by monolayer maturity and p120 availability.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18801083 2008 Expression of E- and N-cadherin and clinicopathology in hepatocellular carcinoma.
18622386 2009 N-cadherin serves as diagnostic biomarker in intrahepatic and perihilar cholangiocarcinomas.
18495274 2008 Potential role of N-cadherin in hepatocyte growth factor (HGF) mediated improvement of the cardiac function of dilated cardiomyopathy mice.
18414176 2008 Is N-cadherin expression important in ductal carcinoma?
18362184 2008 Collagen I-mediated up-regulation of N-cadherin requires cooperative signals from integrins and discoidin domain receptor 1.
18269586 2008 Differential expression of neural-cadherin in pulmonary epithelial tumours.
17944884 2008 Neural cadherin overexpression is a predictive marker for early postoperative recurrence in hepatocellular carcinoma patients.
17868645 2007 Modulation of human Kv1.5 channel kinetics by N-cadherin.
17668445 2008 Compartmentalization in membrane rafts defines a pool of N-cadherin associated with catenins and not engaged in cell-cell junctions in melanoma cells.
17646933 2007 Cadherins are regulated by Ep-CAM via phosphaditylinositol-3 kinase.
17512904 2007 Up-regulation of gastric cancer cell invasion by Twist is accompanied by N-cadherin and fibronectin expression.
17510365 2007 Wilms tumor suppressor WTX negatively regulates WNT/beta-catenin signaling.
17389597 2007 GSK3beta activity modifies the localization and function of presenilin 1.
17348027 2007 The green tea compound, (-)-epigallocatechin-3-gallate downregulates N-cadherin and suppresses migration of bladder carcinoma cells.
17255093 2007 IQ-domain GTPase-activating protein 1 regulates beta-catenin at membrane ruffles and its role in macropinocytosis of N-cadherin and adenomatous polyposis coli.
17229887 2007 NHERF links the N-cadherin/catenin complex to the platelet-derived growth factor receptor to modulate the actin cytoskeleton and regulate cell motility.
17178870 2006 Collagen I promotes metastasis in pancreatic cancer by activating c-Jun NH(2)-terminal kinase 1 and up-regulating N-cadherin expression.
17171299 2007 N-cadherin engagement provides a dominant stop signal for the migration of MDA-MB-468 breast carcinoma cells.
17060906 2006 VEGF controls endothelial-cell permeability by promoting the beta-arrestin-dependent endocytosis of VE-cadherin.
17057644 2006 A distinct PAR complex associates physically with VE-cadherin in vertebrate endothelial cells.
17031402 2006 A specific cadherin phenotype may characterise the disseminating yet non-metastatic behaviour of pseudomyxoma peritonei.
17008425 2007 N-Cadherin is expressed by putative stem/progenitor cells and melanocytes in the human limbal epithelial stem cell niche.
16969099 2006 The role of N-cadherin, MCAM and beta3 integrin in melanoma progression, proliferation, migration and invasion.
16819153 2006 Differential expression of N-cadherin and E-cadherin in normal human tissues.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16707106 2006 Activity-dependent regulation of beta-catenin via epsilon-cleavage of N-cadherin.
16675571 2006 N-cadherin as a novel prognostic marker of progression in superficial urothelial tumors.
16596172 2006 Anti-apoptotic N-cadherin signaling and its prognostic implication in human hepatocellular carcinomas.
16371504 2006 Involvement of Src family kinases in N-cadherin phosphorylation and beta-catenin dissociation during transendothelial migration of melanoma cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16344550 2006 Differential use of functional domains by coiled-coil coactivator in its synergistic coactivator function with beta-catenin or GRIP1.
16258702 2005 N-cadherin expression in breast cancer: correlation with an aggressive histologic variant--invasive micropapillary carcinoma.
16212419 Phosphoproteome analysis of HeLa cells using stable isotope labeling with amino acids in cell culture (SILAC).
16177791 2005 DNA sequence and analysis of human chromosome 18.
16173043 2006 N-cadherin switching occurs in high Gleason grade prostate cancer.
16149052 2005 Genistein-induced neuronal differentiation is associated with activation of extracellular signal-regulated kinases and upregulation of p21 and N-cadherin.
16091424 2005 Modulating the strength of cadherin adhesion: evidence for a novel adhesion complex.
16007225 2005 Adhesion signaling by a novel mitotic substrate of src kinases.
15987741 2005 Transendothelial migration of melanoma cells involves N-cadherin-mediated adhesion and activation of the beta-catenin signaling pathway.
15923648 2005 Close encounters: regulation of vertebrate skeletal myogenesis by cell-cell contact.
15855653 2005 Up-regulated expression of zonula occludens protein-1 in human melanoma associates with N-cadherin and contributes to invasion and adhesion.
15774907 2005 N-cadherin-dependent cell-cell contacts promote human saphenous vein smooth muscle cell survival.
15731052 2005 Gingipains from Porphyromonas gingivalis W83 induce cell adhesion molecule cleavage and apoptosis in endothelial cells.
15713751 2005 Cadherin switching: essential for behavioral but not morphological changes during an epithelium-to-mesenchyme transition.
15701645 2005 Gonadotropins regulate N-cadherin-mediated human ovarian surface epithelial cell survival at both post-translational and transcriptional levels through a cyclic AMP/protein kinase A pathway.
15648948 2004 N-cadherin as an invasion promoter: a novel target for antitumor therapy?
15541732 2005 Sp1/Sp3 and the myeloid zinc finger gene MZF1 regulate the human N-cadherin promoter in osteoblasts.
15527101 2004 Correlation of N-cadherin expression in high grade gliomas with tissue invasion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355896 2004 N-cadherin is regulated by activin A and associated with tumor aggressiveness in esophageal carcinoma.
15331629 2004 Critical role of N-cadherin in myofibroblast invasion and migration in vitro stimulated by colon-cancer-cell-derived TGF-beta or wounding.
15263022 2004 Roles played by a subset of integrin signaling molecules in cadherin-based cell-cell adhesion.
15252840 2004 Neoexpression of N-cadherin in E-cadherin positive colon cancers.
15217949 2004 N-cadherin expression and epithelial-mesenchymal transition in pancreatic carcinoma.
15192701 2004 PS1 activates PI3K thus inhibiting GSK-3 activity and tau overphosphorylation: effects of FAD mutations.
15153430 2004 Cadherin switch in tumor progression.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14675278 2004 Cadherin expression pattern in melanocytic tumors more likely depends on the melanocyte environment than on tumor cell progression.
14625392 2003 A novel cell-cell junction system: the cortex adhaerens mosaic of lens fiber cells.
14559901 2003 Two regions of cadherin cytoplasmic domains are involved in suppressing motility of a mammary carcinoma cell line.
14515347 2003 Presenilin 1 is involved in maturation and trafficking of N-cadherin to the plasma membrane.
13678586 2003 A CBP binding transcriptional repressor produced by the PS1/epsilon-cleavage of N-cadherin is inhibited by PS1 FAD mutations.
12634428 2003 Promyogenic members of the Ig and cadherin families associate to positively regulate differentiation.
12604612 2003 N-cadherin-catenin complexes form prior to cleavage of the proregion and transport to the plasma membrane.
12545205 2002 Carbohydrate moieties of N-cadherin from human melanoma cell lines.
12531901 2003 RICS, a novel GTPase-activating protein for Cdc42 and Rac1, is involved in the beta-catenin-N-cadherin and N-methyl-D-aspartate receptor signaling.
12503652 2002 Expression of adhesion and extracellular matrix molecules in the developing human brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12398894 2002 A signaling pathway leading to metastasis is controlled by N-cadherin and the FGF receptor.
12377785 2002 PTP1B modulates the association of beta-catenin with N-cadherin through binding to an adjacent and partially overlapping target site.
12151522 2002 Recruitment of the kainate receptor subunit glutamate receptor 6 by cadherin/catenin complexes.
12095980 2002 Signal transduction from N-cadherin increases Bcl-2. Regulation of the phosphatidylinositol 3-kinase/Akt pathway by homophilic adhesion and actin cytoskeletal organization.
12057916 2002 E- and N-cadherin distribution in developing and functional human teeth under normal and pathological conditions.
11996105 2000 Expression of beta1-integrins and N-cadherin in bladder cancer and melanoma cell lines.
11821434 2002 The Erbin PDZ domain binds with high affinity and specificity to the carboxyl termini of delta-catenin and ARVCF.
11790800 2002 Cadherin-mediated cell sorting not determined by binding or adhesion specificity.
11729199 2002 Densin-180 interacts with delta-catenin/neural plakophilin-related armadillo repeat protein at synapses.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11136230 2001 Interaction of Galpha 12 and Galpha 13 with the cytoplasmic domain of cadherin provides a mechanism for beta -catenin release.
11058098 2000 The armadillo repeat region targets ARVCF to cadherin-based cellular junctions.
10862698 2000 Proteomic analysis of NMDA receptor-adhesion protein signaling complexes.
10818391 2000 Follicular atresia and luteolysis. Evidence of a role for N-cadherin.
10662782 2000 Functional cis-heterodimers of N- and R-cadherins.
9971746 1999 delta-catenin, an adhesive junction-associated protein which promotes cell scattering.
9615235 1998 Localization of human cadherin genes to chromosome regions exhibiting cancer-related loss of heterozygosity.
9542583 1998 Distribution of N-cadherin and NCAM in neurons and endocrine cells of the human embryonic and fetal gastroenteropancreatic system.
9508779 1998 Differential localization of VE- and N-cadherins in human endothelial cells: VE-cadherin competes with N-cadherin for junctional localization.
9199196 1997 Multiple cadherins are expressed in human fibroblasts.
9168198 1996 Shared cell adhesion molecule (CAM) homology domains point to CAMs signalling via FGF receptors.
7995652 1994 Expression and localization of N- and E-cadherin in the human testis and epididymis.
7959764 1994 Structure of the human N-cadherin gene: YAC analysis and fine chromosomal mapping to 18q11.2.
7806582 1994 E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.
7731968 1995 Expressed cadherin pseudogenes are localized to the critical region of the spinal muscular atrophy gene.
7650039 1995 Identification of plakoglobin domains required for association with N-cadherin and alpha-catenin.
2384753 1990 N-cadherin gene maps to human chromosome 18 and is not linked to the E-cadherin gene.
2216790 1990 Human N-cadherin: nucleotide and deduced amino acid sequence.
1639850 1992 Plakoglobin, or an 83-kD homologue distinct from beta-catenin, interacts with E-cadherin and N-cadherin.
1500442 1992 Extrajunctional distribution of N-cadherin in cultured human endothelial cells.