Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.04
PubTator Score 7.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -2.000 4.4e-02
posterior fossa group A ependymoma -1.900 1.1e-07
oligodendroglioma -1.300 1.2e-02
psoriasis -1.400 7.9e-08
group 4 medulloblastoma -2.300 6.8e-04
adrenocortical adenoma -1.635 4.4e-04
adrenocortical carcinoma -1.706 7.7e-08
non-small cell lung cancer -1.281 3.5e-17
intraductal papillary-mucinous adenoma (... -2.400 1.3e-03
intraductal papillary-mucinous carcinoma... -2.200 1.8e-02
colon cancer -4.200 3.0e-12
lung cancer -1.700 5.2e-03
interstitial cystitis 2.200 1.7e-03
lung adenocarcinoma -1.400 9.7e-09
atypical teratoid/rhabdoid tumor -1.700 1.1e-03
pilocytic astrocytoma 3.300 9.5e-04
Pick disease -1.200 3.1e-03
progressive supranuclear palsy -1.900 1.0e-02
Breast cancer -1.300 3.6e-03
ovarian cancer -1.800 7.2e-05
Down syndrome 1.600 2.1e-03

Gene RIF (1)

PMID Text
25361488 Gene expression profiling of Glioblastoma stem-like cells has shown CDH19 to be an exciting new target for drug development and study of glioblastoma multiforme tumorigenesis

AA Sequence

MNCYLLLRFMLGIPLLWPCLGATENSQTKKVKQPVRSHLRVKRGWVWNQFFVPEEMNTTSHHIGQLRSDL      1 - 70
DNGNNSFQYKLLGAGAGSTFIIDERTGDIYAIQKLDREERSLYILRAQVIDIATGRAVEPESEFVIKVSD     71 - 140
INDNEPKFLDEPYEAIVPEMSPEGTLVIQVTASDADDPSSGNNARLLYSLLQGQPYFSVEPTTGVIRISS    141 - 210
KMDRELQDEYWVIIQAKDMIGQPGALSGTTSVLIKLSDVNDNKPIFKESLYRLTVSESAPTGTSIGTIMA    211 - 280
YDNDIGENAEMDYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHHVPEQLMKYHT    281 - 350
EASTTFIKIQVEDVDEPPLFLLPYYVFEVFEETPQGSFVGVVSATDPDNRKSPIRYSITRSKVFNINDNG    351 - 420
TITTSNSLDREISAWYNLSITATEKYNIEQISSIPLYVQVLNINDHAPEFSQYYETYVCENAGSGQVIQT    421 - 490
ISAVDRDESIEEHHFYFNLSVEDTNNSSFTIIDNQDNTAVILTNRTGFNLQEEPVFYISILIADNGIPSL    491 - 560
TSTNTLTIHVCDCGDSGSTQTCQYQELVLSMGFKTEVIIAILICIMIIFGFIFLTLGLKQRRKQILFPEK    561 - 630
SEDFRENIFQYDDEGGGEEDTEAFDIAELRSSTIMRERKTRKTTSAEIRSLYRQSLQVGPDSAIFRKFIL    631 - 700
EKLEEANTDPCAPPFDSLQTYAFEGTGSLAGSLSSLESAVSDQDESYDYLNELGPRFKRLACMFGSAVQS    701 - 770
NN                                                                        771 - 772
//

Text Mined References (13)

PMID Year Title
25361488 2015 Myelin-forming cell-specific cadherin-19 is a marker for minimally infiltrative glioblastoma stem-like cells.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
20358601 2010 A maternally inherited chromosome 18q22.1 deletion in a male with late-presenting diaphragmatic hernia and microphthalmia-evaluation of DSEL as a candidate gene for the diaphragmatic defect.
18364357 2008 Monocyte chemotactic protein (MCP)-1 promotes angiogenesis via a novel transcription factor, MCP-1-induced protein (MCPIP).
18184143 2008 A novel locus for ectodermal dysplasia of hairs, nails and teeth type maps to chromosome 18q22.1-22.3.
16177791 2005 DNA sequence and analysis of human chromosome 18.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12118382 2002 Delineation and candidate gene mutation screening of the 18q22 minimal region of deletion in head and neck squamous cell carcinoma.
10995570 2000 Characterization of three novel human cadherin genes (CDH7, CDH19, and CDH20) clustered on chromosome 18q22-q23 and with high homology to chicken cadherin-7.
9615235 1998 Localization of human cadherin genes to chromosome regions exhibiting cancer-related loss of heterozygosity.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.